Ngày tải lên: 02/01/2015, 17:33
Ngày tải lên: 02/01/2015, 17:33
Tài liệu Báo cáo Y học: Dinucleoside polyphosphates stimulate the primer independent synthesis of poly(A) catalyzed by yeast poly(A) polymerase ppt
... end of mRNA [2,3], forming a complex with two cleaving factors and a polyadenylation factor [4,5]. The core yeast poly (A) polymerase appears to have a molecular mass of around 63 kDa [3]. Separated form ... amount of ATP in the control, indicates the ATP present at the start of the reaction (Fig. 2A) ; the ATP that was consumed after incubation with the polymerase (Fig. 2B), was totally recovered as AMP ... m M Ap n As. The relative efficiency of diadenosine polyphosphates to stimulate the synthesis of poly (A) , considering a media of four experiments, was: Ap 6 A, 61; Ap 4 A, 51; Ap 2 A, 41; Ap 5 A, ...
Ngày tải lên: 21/02/2014, 01:21
The Corporate Governance Lessons from the Financial Crisis docx
... development and refinement of corporate governance standards has often followed the occurrence of corporate governance failures that have highlighted areas of particular concern. The burst of the ... boards of these banks have not been capable of responding to a changing business model. The banks used to have a business model based on an AAA credit rating due to a guarantee by the federal and ... governance at the company level The first part of the article presents a thumbnail sketch of the macroeconomic and structural conditions that confronted banks and their corporate governance arrangements...
Ngày tải lên: 15/03/2014, 19:20
Working Paper No. 446 The business cycle implications of banks’ maturity transformation potx
... inflation. The reduction in inflation increases the real value of banks nominal assets and banks are therefore better off on impact. However, the fall in the demand for capital and the associated ... that asset prices of banks with a large maturity mismatch on their balance sheets react more to unanticipated interest rate changes than asset prices of banks with a small maturity mismatch. Additionally, ... ie an exogenous increase in r nom t . The real part of the model is calibrated as in Table A. The parameters associated to the nominal frictions are calibrated as follows. Inflation in the steady...
Ngày tải lên: 22/03/2014, 21:20
Báo cáo khoa học: Identification of the N-terminal region of TjZNT2, a Zrt⁄Irt-like protein family metal transporter, as a novel functional region involved in metal ion selectivity ppt
... 1:MFFIDVLWKLFPLYLFGSERDYLSETESILKIVPETMAAASSLSILCDAGEPDLCRDDSAAFLLKLVAIASIF T jZNT1 37:LAGVAGVAIPLIGKNRRFLQTEGNLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPDYPWSKFPFPGFFA T jZNT2 74:LAGAAGVAIPLIGRNRRFLQTDGSLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPEFPWKKFPFPGFFA T jZNT1 ... microarray analysis of Arabidopsis thaliana and Arabidopsis halleri roots identi- fies nicotianamine synthase, a ZIP transporter and other genes as potential metal hyperaccumulation factors. Plant ... through the study of transcript regulation as a molecular biological approach and the determination of the N-terminal sequence as a biochemical approach. Experimental procedures DNA manipulations The...
Ngày tải lên: 29/03/2014, 00:20
LIBERALIZATION, CORPORATE GOVERNANCE, AND SAVING BANKS pdf
... negatively related. There are a number of studies that have examined corporate governance in the banking industry in Spain. Crespí, Garc a- Cestona, and Salas (2004) analyzed corporate governance ... natural experiment, relating liberalization and corporate governance: the geographic deregulation of savings banks in Spain. The ultimate removal of branching barriers in 1989 led to a dramatic ... The influence of political and physical distance on the geographic expansion of savings banks This figure shows the main patterns of savings banks geographic expansion. Savings banks are classified...
Ngày tải lên: 29/03/2014, 08:20
deliberating in the real world problems of legitimacy in deliberative democracy aug 2006
... of assuming that all women are the same, all workers vote Labour, or all members of any identifiable group think the same way, feel the same way, and have the same hopes and dreams. Essentializing ... representatives lack accountability to non-participants. Similarly, I look at the advantages and disadvantages of elected representation and what a few interviewees called ‘championing’ to see what they add ... Habermas (1984), Rehg (1996: 87–8), Schlosberg (1999), and Young (2000: 167). area of it, the establishment of Primary Care Groups, 10 and asked, ‘What are the advantages and disadvantages of...
Ngày tải lên: 11/06/2014, 00:01
báo cáo hóa học: " The possible link between the elevated serum levels of neurokinin A and anti-ribosomal P protein antibodies in children with autism" pot
... receptor antagonists are a potential new class of anti-inflammatory medicaions in immune-mediated diseases.[8-10]. Autoimmunity may have a role in the pathogenesis of autism in a subgroup of patients. ... anti-ribosomal P levels, respectively of healthy controls as the distribution of the data was non-parametric. 4 Background Neurogenic inflammation encompasses a series of vascular and non-vascular ... significant cross-reactivity or interference was observed. Statistical analysis The results were analyzed by commercially available software package (Statview, Abacus concepts, inc., Berkley, CA,...
Ngày tải lên: 19/06/2014, 22:20
báo cáo hóa học:" Research Article Solving the Set Equilibrium Problems Yen-Cherng Lin and Hsin-Jung Chen" pot
Ngày tải lên: 21/06/2014, 11:20
báo cáo khoa học: " NAOMI: The trials and tribulations of implementing a heroin assisted treatment study in North America" ppsx
Ngày tải lên: 11/08/2014, 18:20
Báo cáo y học: " Analysis of the PDZ binding specificities of Influenza A Virus NS1 proteins" ppt
Ngày tải lên: 11/08/2014, 21:21
daily et al - 2003 - corporate governance decades of dialogue and data
Ngày tải lên: 02/01/2015, 17:34
cohen et al - 2004 - the corporate governance mosaic and financial reporting quality
Ngày tải lên: 06/01/2015, 19:49
university of chicago press a history of corporate governance around the world family business groups to professional managers jan 2006
... countries as Australia, Russia, Spain, and Switzerland, not to mention much of Asia and all of Latin America, Africa, and the Middle East. It is our hope that other students of corporate finance or ... barriers—upward or downward, and the rise and fall of whole classes. These factors are chance; shrewd man- agement of the families’ position, especially via advantageous arranged marriages; differences ... authors speculate that an emasculation of the estate tax and a dramatic expansion of state intervention in the economy may have been factors. The erosion of the estate tax permitted large fortunes...
Ngày tải lên: 11/06/2014, 15:48
lei - determinants of cg and the link between cg and performance - evidence from the uk using a corporate governance scorecard
Ngày tải lên: 06/01/2015, 19:48
ferris et al - 2009 - the effect of crosslisting on corporate governance - a review
Ngày tải lên: 06/01/2015, 19:49
Tài liệu Project (written version):“The problems of the “Citibus” (bus operating company) and their possible solutions. Drawing a contract.” doc
... the roads that doesn’t cope with the growing number of cars and other carriers, build new roads and rearrange the traffic within the city in general); another highly probable reason is that the ... other laws of Ukraine and to make this document has a legal effect). On the next stage both parties sign the contract and we think that the drivers are enough motivated, they fulfil the terms and ... 2 The problems of the “Citibus” (bus operating company) and their possible solutions. Drawing a contract.” By: Arustomjan Nona Chukhno Sergey Dubovitsky Roman Feofilaktova Yevgenja Shashkova...
Ngày tải lên: 20/12/2013, 19:15