... hypothesis would demonstrate that (anti-gp120 × anti-C3d)-Fc can bind to HIV virions and can result in an amplification of the complement activation cascade As a consequence of this action, HIV would ... bispecific antibody is constructed through incorporating the dsFv against gp120 and the dsFv against C3d, then linking to a complement-activator (human IgG1 Fc domain) The trifunctional bispecific antibody, ... disease is bispecific antibodies (BsAbs) that can bind to two distinct epitopes Besides the dual-specific antigen binding fragment (Fab) parts, they contain an Fc portion and can Jia et al Virology...
Ngày tải lên: 12/08/2014, 04:20
... ( 1A4 A-1, 3B 2A- 9 and 1A3 B-7) Humanisation of CUF37- 2a will be essential if this antibody is to find use as an antiviral in humans and these data suggest that CUF37- 2a may be a suitable candidate ... into a murine IgG 2a kappa antibody, which was designated CUF37- 2a Murine IgG 2a was chosen as the framework as it has equivalent biological and functional activities to human IgG1 The amino acid ... propiolactone-inactivated TC-83 antigen and HRP-conjugated mouse anti-phage M13 (Amersham Pharmacia Biotech, U.K.) as the secondary antibody Absorbance values greater than twice the background...
Ngày tải lên: 12/08/2014, 04:21
Báo cáo y học: "Endoscopic Facet Debridement for the treatment of facet arthritic pain – a novel new technique
... were diagnosed with facet pain Primary outcome measure was percent change in facet-related pain as measured by Visual Analog Scale (VAS) score at final follow-up visit Secondary outcome was change ... investigate the long-term efficacy of facet debridement for the treatment of chronic back pain originating in the facet joint MATERIALS AND METHODS Patient enrollment and evaluation All patients treated ... 71% of 21 patients at one year follow-up with laser denervation of the dorsal facet capsule Li et al treated patients with RFA of the dorsal rami Three patients had durable response after to 16...
Ngày tải lên: 26/10/2012, 09:32
Báo cáo y học: " A Novel Variable Number of Tandem Repeat of the Natriuretic Peptide Precursor B gene’s 5’-Flanking Region is Associated with Essential Hypertension among Japanese Females"
... 1145-9 Tamura N, Ogawa Y, Chusho H, et al Cardiac fibrosis in mice lacking brain natriuretic peptide Proc Natl Acad Sci USA 2000; 97: 4239-44 Mukoyama M, Nakao K, Saito Y, et al Human brain natriuretic ... like to thank Dr Y Watanabe and Dr Y Izumi for collecting the samples, and Ms H Tobe, M Nakamura, and K Sugama for their technical assistance This work was supported financially by a grant from ... Japanese Circ Res 2000; 86: 841-5 13 Nakayama T, Soma M, Rahmutula D, Ozawa Y, Kanmatsuse K Isolation of the 5'-flanking region of genes by thermal asymmetric interlaced polymerase chain reaction...
Ngày tải lên: 26/10/2012, 10:04
Báo cáo y học: " Vgf is a novel biomarker associated with muscle weakness in amyotrophic lateral sclerosis (ALS), with a potential role in disease pathogenesis"
... Yamaguchi H, Sasaki K, Satomi Y, Shimbara T, Kageyama H, Mondal MS, Toshinai K, Date Y, Gonzalez LJ, Shioda S, Takao T, Nakazato M, Minamino N Peptidomic identification and biological validation of ... Lange DJ, Voustianiouk A, Macgrogan D, Ho L, Suh J, Humala N, Thiyagarajan M, Wang J, Pasinetti GM A ketogenic diet as a potential novel therapeutic intervention in amyotrophic lateral sclerosis ... Cruz Biotech, CA) The assay was developed using a stabilized HRP substrate All samples were analyzed in the linear range of the ELISA using over-expressed human Vgf as a standard Assessment of...
Ngày tải lên: 03/11/2012, 10:52
Domestic Wastewater Reclamation Coupled with Biofuel/Biomass Production Based on Microalgae: A Novel Wastewater Treatment Process in the Future
... Carbon Capture and Storage (CCS) Organic flocculants Primary Flocculation settlement tank and filtration CO2 Wetland plants Microalgae cultivation and reclamation Wastewater Artificial wetland ... system are wastes (wastewater, waste CO2), and the outputs are valuable products (reclaimed water, biofuel/biomass, organic fertilizer and organic flocculants) - 201 - Journal of Water and Environment ... be applied By separating microalgal cells from the wastewater, clean water with low content of organics and inorganic nutrients could be obtained, and also the microalgal biomass could be harvested...
Ngày tải lên: 05/09/2013, 10:17
Research on a novel buck boost converter for wind turbine systems
... inverters can accommodate a wide range of input dc voltage for an improved energy output from variable wind turbine resources The input source and the output grid are separated based on flyback operation ... (DCM); the averaged current of Mode is the average output current of the inverter and can be expressed as, 230 vc is the capacitor voltage and is in the same order as the grid voltage The voltage stresses ... reference wave, serving as the modulating signal, is compared with a triangular wave, serving as the carrier signal The intersection points determine the switching angles and pulse widths as in Figure...
Ngày tải lên: 03/01/2014, 19:16
A novel interval method for validating state enclosures of the
... the words validated, guaranteed, and verified are used interchangeably to denote that state enclosures are mathematically and not only empirically proven to be correct Traditional validated techniques ... engineering are analysis and design of robust, optimal, and adaptive controllers For nonlinear systems, robustness analysis with respect to uncertain initial states and parameters can be performed by calculating ... ode45s has been used with an equally spaced grid {ti }, ti − ti−1 = 5·10−4 Mean-value rule (MVR) evaluation and advanced interval methods (AIM) have been applied to evaluate the iteration formula...
Ngày tải lên: 12/01/2014, 22:04
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... 277 283 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK *****::*.** : ... Toyobo (Osaka, Japan) Emulgen 911 was a gift from Kao Chemical (Tokyo, Japan) NADPH, NADH and NADP+ were purchased from Oriental Yeast (Tokyo, Japan) a- Cyano-4-hydroxycinnamic acid was obtained from ... :.:: : * : * NAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKA-EFQGK-RVLIVGGGDS -EYTCDALIIATGASA -RYLGLPSEEAFKGRGVSACATCDG-FFYRNQKVAVIGGGNT LEVKARTVILAVGSRR -RKLGVPGEAELAGRGVSYCSVCDAPLFKGKDAVVVVGGGDS...
Ngày tải lên: 18/02/2014, 08:20
Tài liệu Báo cáo khoa học: Isolation and molecular characterization of a novel D-hydantoinase from Jannaschia sp. CCS1 docx
... subunit molecular mass was also estimated by SDS–PAGE Characterization and comparative analyses of HYDJs and HYDBp The optimal temperature for activity of HYDJs with d-pHPH as substrate was determined ... optically pure amino acids Results Genome database mining and identification of putative D-hydantoinase genes The whole genome sequences of various microorganisms available in various public databases ... HYDJs and DCase Although almost all hydantoinases that are currently applied in industry were obtained from microbial sources, the exact metabolic function and natural substrates of hydantoinases...
Ngày tải lên: 18/02/2014, 08:20
Tài liệu Báo cáo khoa học: TransLISA, a novel quantitative, nonradioactive assay for transcription factor DNA-binding analyses pdf
... Biotin-TCGACTAGAAGCTTCTAGAAGCTTCTAG AGCTGATCTTCGAAGATCTTCGAAGAT Biotin-TCGACTTCAAGCTTGTACAAGCTTGTAG AGCTGAAGTTCGAACATGTTCGAACATC Biotin-AACGACGGTCGCTCCGCCTGGCT nM Unlabeled HSE DNA-binding activity ... Incubation 1.5 mL tube 30 Pipet to plate, add A beads and incubate PAGE Autoradiography A + 2h D +16 h 1h Add D beads and incubate O2 D A Read AlphaLISA signal at 615 nm Fig Comparison of EMSA and ... confirm that the assay specifically measures HSF1 DNA-binding activity Analytical range and precision The analytical range of the assay was evaluated using known concentrations of recombinant human HSF1...
Ngày tải lên: 18/02/2014, 14:20
Tài liệu Báo cáo khoa học: Verprolin function in endocytosis and actin organization Roles of the Las17p (yeast WASP)-binding domain and a novel C-terminal actin-binding domain doc
... pAM237 pAM241 pAM252 pAM253 pAM872 pAM873 pAM874 pAM875 pAM876 pAM877 pAM878 pAM879 pAM880 pAM881 pAM882 pAM883 pAM884 pAM885 pAM886 pAM887 pAM888 pAM889 pAM890 pAM891 pAM892 pAM895 pAM896 pAM899 ... GFP-specific antiserum was a gift from J Kahana and P Silver (Dana Farber Cancer Center, Boston, MA) The anti-actin mAb was MAB1501 from Chemicon International (Temecula, CA) The anti-hexokinase rabbit ... bar1) [23], IDY166 (MATa his3 leu2 ura3 trp1 las17D::URA3) [20], and PJ69- 4A (MATa his3 leu2 ura3 trp1 gal4D gal80D met2::GAL7-lacZ GAL2-ADE2 LYS2::GAL1–HIS3) [64] Yeast strain PJ69- 4A was a...
Ngày tải lên: 18/02/2014, 16:20
Tài liệu Báo cáo khoa học: Identification of a novel matrix protein contained in a protein aggregate associated with collagen in fish otoliths pdf
... TCATCAT-3¢; rOMM-64-IV, 5¢-CGCGGATCCGCCCCT GTTAATGATGGAACC-3¢ and 5¢-CGCCTCGAGCTAA GAAGACTGGGCTGCCAG-3¢; rOMM-64-V, 5¢-CGCGG ATCCAGGCAAGATTTTAAGCATCCA-3¢ and 5¢-CGCC TCCACCTAAGAGGCATCCTTGTCCAC-3¢; ... 5¢-CGCCTCCA CCTAAGAGGCATCCTTGTCCAC-3¢; rOMM-64-II, 5¢CGCGGATCCACCGTAGACACTTATGATATA-3¢ and 5¢-CGCCTCGAGCTAAGAGTCAGCTTGCACGTC-3¢; rOMM-64-III, 5¢-CGCGGATCCGCTGATGTGACCAGT GATGAC-3¢ and 5¢-CGCCTCGAGCTATTTGGGCTCTT ... genomic DNA contamination in the total RNA was confirmed by lack of amplification of a b-actin mRNA fragment by PCR using a pair of primers (5¢-ATCACCATCGGCAACGAGAG-3¢ and 5¢-TGGAGTTGTAGGTGGTCTCGTG-3¢)...
Ngày tải lên: 18/02/2014, 17:20
Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx
... methylated DNA were: 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense) Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGT ATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCT ACTT-3¢ ... used were: 5¢-CAGCAATTGTCACACATCAAGAA-3¢ (sense) and 5¢-T-ACATGTAGGTATGAAGACATCGTC T-3¢ (antisense) for exon 9; 5¢-TCCCTGCTTCCTCTGGC GGA-3¢ (sense) and 5¢-AGCCATAGCCATAGCCACTTC C-3¢ (antisense) for ... and 5¢-CGGTTCAGGTACTCAGT CATCCA-3¢ (antisense) for Bcl-2; and 5¢-ACGGGAGAT GACAATGGAGAAAT-3¢ (sense) and 5¢-CATGGGTAG CAGCTCCTTCTTC-3¢ (antisense) for Apaf-1 Total RNA was extracted from cultured...
Ngày tải lên: 18/02/2014, 18:20
Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt
... receptors, and invertebrate tachykinins: a review Zool Sci 5, 533–549 Satake H, Ogasawara M, Kawada T, Masuda K, Aoyama M, Minakata H, Chiba T, Metoki H, Satou Y & Satoh N (2004) Tachykinin and tachykinin ... VII Val-Asn-Pro-Tyr-Ser-Phe-Gln-Gly-Thr-Arg-NH2 Leu-Asn-Ala-Asn-Ser-Phe-Met-Gly-Ser-Arg-NH2 Thr-Val-Ser-Ala-Asn-Ala-Phe-Leu-Gly-Ser-Arg-NH2 Ser-Asp-Ala-Leu-Ala-Phe-Val-Pro-Thr-Arg-NH2 Met-Asn-Ser-Leu-Ser-Phe-Gly-Pro-Pro-Lys-NH2 ... salivary vasodilator of the yellow fever mosquito, Aedes aegypti Insect Mol Biol 8, 459–467 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K & Minakata H (2003) Isolation and characterization of novel...
Ngày tải lên: 19/02/2014, 00:20
Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt
... mitochondria was analyzed by thiobarbituric acid assay [34] In this assay, thiobarbituric acid reacts with malonaldehyde and or other carbonyl by-products of free-radicalmediated lipid peroxidation ... thiobarbituric acid reactive substances (TBARS) as a marker for lipid peroxidation, and 6-CySeCD, 6-SeCD and Ebselen as antioxidants in ferrous sulfate ascorbate-induced mitochondrial damage ... materials were of analytical grade and obtained from Beijing Chemical Plant (Beijing, China) decrease of NADPH absorption at 340 nm (eNADPH ẳ 6220 m)1 cm)1) Background absorption of the noncatalytic...
Ngày tải lên: 19/02/2014, 02:20
Tài liệu Báo cáo khoa học: Characterization of the interaction between the plasma membrane H+-ATPase of Arabidopsis thaliana and a novel interactor (PPI1) doc
... from clones isolated previously [22] using the following primers: gatggatcccatATGGGTG TTGAAGTTGTA annealing around the start codon of the Ppi1 ORF and gactcgagATTAGTCGACTTCTTACGC annealing just before ... interaction partner for the C-terminus of Arabidopsis thaliana plasma membrane H+-ATPase (AHA1 isoform): site and mechanism of action on H+-ATPase activity differ from those of 14-3-3 proteins Plant ... the plasma membrane H+-ATPase Plant Physiol 103, 391–398 Regenberg B, Villalba JM, Lanfermeijer FC & Palmgren MG (1995) C-terminal deletion analysis of plant plasma membrane H+-ATPase: yeast as...
Ngày tải lên: 19/02/2014, 07:20
Tài liệu Báo cáo khóa học: TbPDE1, a novel class I phosphodiesterase of Trypanosoma brucei pdf
... and pET-PDE1 as template PDE1(Arg189–Thr620) was amplified using the primer pairs 5¢-GGGAATTCCATATGAGAGACAATA TTTCCCGTTTATCAAATC-3¢ and 5¢-CCGCTCGAGT CATTACTAGGTTCCCTGTCCAGTGTTACC-3¢, and PDE1(Lys321–Thr620) ... PDE1(Lys321–Thr620) was amplified with primers 5¢-GGG AATTCCATATGAAGAATGATCAATCTGGCTGCG GCGCAC-3¢ and 5¢-CCGCTCGAGTCATTACTAGG TTCCCTGTCCAGTGTTACC-3¢ The resulting DNA fragments (1.29 and 0.90 kbp) were ... Melville, Cambridge University) using Takara Taq polymerase (BioWhittaker) and 30 cycles of 30 s at 94 °C, at 58 °C and at 72 °C For amplification, the primer pairs 5¢-GGGAATTCCATA TGCTTGAGGCTTTGCGAAAGTGCCCGACCATGT...
Ngày tải lên: 19/02/2014, 12:20
Tài liệu Báo cáo khóa học: New activities of a catalytic antibody with a peroxidase activity ppt
... degradation was less important in the case of the antibody MP8 catalyst, which showed that the antibody protected the heme against oxidative degradation and led to higher yields in sulfoxide In addition, ... S-oxidation of thioanisole As the above results showed that the best system for the S-oxidation of thioanisole associated H2O2 as an oxidant with MP8 as a catalyst in the presence of tBuOH as an ... best case, because an oxidative degradation of the catalyst occurred This was shown by a progressive disappearance, in its absorption spectrum, of the soret band at 396 nm that is characteristic...
Ngày tải lên: 19/02/2014, 12:20
Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt
... 4,6-disubstituted-HexN and, in small amounts, terminal-Rha and 6-substituted-Glc In addition, the disaccharide 7-O-carbamoyl-Hep-(1fi3)Hep was found Fatty acid analysis revealed the presence of typical fatty acids ... oligosaccharides from Pseudomonas strains have already been isolated and characterized [12,13], mainly from Pseudomonas aeruginosa strains [21,37–43] The carbohydrate backbone of the so-called ... chromatography, which was purified further and the resulting oligosaccharide (Fig 6) analyzed by compositional/methylation analyses, 2D NMR and mass spectrometry Compositional and methylation analyses...
Ngày tải lên: 19/02/2014, 13:20