separability dual of l p

... complete oxidative pentose phosphate pathway in chloroplasts and an incomplete pathway in the cytosol of spinach leaves Plant Physiol 108, 609–614 Gross, K.C & Phar, D.M (1982) A potential pathway ... regulation of other genes On the other hand, the lack of growth of the wildtype strain on D-allitol and L- iditol may either be due to a lack of uptake of these hexitols, or due to a lack of lad1 ... 8.67 0.35 0.20 0.10 0.13 0.01 D-Talitol Galactitol D-Sorbitol D-Allitol L- Mannitol L- Iditol D-Arabino-3-hexulose L- Xylo-3-hexulose D-Fructose D-Psicose L- Sorbitol L- Tagatose D-Sorbose (± (± (± (±...

Ngày tải lên: 07/03/2014, 15:20

... 2009 Fig L- Arginine efflux in human platelets Platelets (1.0 · 109 platelets), loaded for 15 at 37 °C with lCiÆmL)1 L- [2,3,4-3H]arginine and unlabelled L- arginine (5 lM) in the presence of saline (j ... duplicate wP < 0.0005; P < 0.0025 vs total efflux NEM, N-ethylmaleimide Effect of N-ethylmaleimide and L- leucine on NO formation and cGMP levels To evaluate the effect of N-ethylmaleimide or L- leucine ... of L- arginine transport in peripheral blood mononuclear cells was shown Thus the control of L- arginine transport might be a therapeutic target to regulate intracellular NO production In conclusion...

Ngày tải lên: 08/03/2014, 02:20

... 12 2 PCho•Hex3•Hep3•PEtn1 P1 •Kdo•Lipid A-OH PCho•Hex3•Hep3•PEtn2 P1 •Kdo•Lipid A-OH PCho•Hex4•Hep3•PEtn1 P1 •Kdo•Lipid A-OH PCho•Hex4•Hep3•PEtn2 P1 •Kdo•Lipid A-OH Hex4•Hep4•PEtn1 P1 •Kdo•Lipid A-OH ... PCho•Hex1•Hep3•PEtn1•AnKdo-ol PCho•Hex2•Hep3•PEtn1•AnKdo-ol PCho•Hex3•Hep3•PEtn1•AnKdo-ol PCho•Hex4•Hep3•PEtn1•AnKdo-ol PCho•HexNAc1•Hex4•Hep3•PEtn1•AnKdo-ol Hex2•Hep4•PEtn1•AnKdo-ol Hex3•Hep4•PEtn1•AnKdo-ol ... 3.77 HepIII fi2) -L- a-D–Hepp-(1fi 6› PEtn fi2) -L- a-D–Hepp-(1fi 5.05–5.18a 97.4–98.8a 5.62–5.73a GlcI fi6)-b-D-Glcp-(1fi HepIV fi6) -L- a-D–Hepp-(1fi GalI b-D-Galp-(1fi GlcII fi4)-b-D-Glcp-(1fi GalII b-D-Galp-(1fi...

Ngày tải lên: 08/03/2014, 08:20

... assembly of the (H -L) 6fhx1 complex takes place The successfully assembled elementary units are allowed by the ER quality control system and transported efficiently to Golgi complex Two types of N-linked ... (about 300 ng each) was dissolved in lL of NaCl/Pi (137 mM NaCl, 2.68 mM KCl, 8.1 mM Na2HPO4, 1.47 mM KH2PO4), mixed with lL of lgÆlL)1 solution of the purified Bacillus sp a1,2-mannosidase (EC 3.2.1.24) ... extremely low level of normal L- chain It implies that numbers of the normal elementary unit are assembled in proportion to the available numbers of the normal L- chain, and the N-linked oligosaccharide...

Ngày tải lên: 16/03/2014, 16:20

... selectively 15N-labelled DOPA–PpiB relative to native 15 N-labelled PpiB were consistent with the specific incorporation of DOPA in place of tyrosine Translational incorporation of DOPA into proteins ... cell-free extract HPLC–ESI-MS of tryptic peptides from DOPA-labelled His6-PpiB Peptides resulting from partial tryptic digestion of His6-PpiB that had been produced using mm tyrosine or mm DOPA ... N-HSQC spectrum of the 15N-labelled DOPA–PpiB sample could only be explained by uniform and > 90% incorporation of DOPA in place of any of the three tyrosines The signal-to-noise ratio in the spectrum...

Ngày tải lên: 16/03/2014, 22:20

... the outputs of port and port 3, and the lossless divider is not matched at all ports, and the resistive power divider is lossy The Wilkinson power divider has all ports matched and has isolation ... et al / VNU Journal of Science, Mathematics - Physics 25 (2009) 185-189 Generally, Wilkinson power divider can have any number of output ports A basic three port Wilkinson power divider of port ... the larger modules from the smaller ones and we anticipate to applicate this method for raising the output power in near future Acknownlegment The results of this work belong to the research project...

Ngày tải lên: 22/03/2014, 11:20

... Irr(Sm ) with m ≥ L Let L be a Levi subgroup of G and let w0 (resp w0 ) be the longest element in the Weyl group of G (resp L) We denote by wL the Weyl group L element w0 w0 In particular wM is defined, ... statement follows from Lemma 10, after passing to any K-type 912 EREZ LAPID AND STEPHEN RALLIS To prove the second part, we will apply the discussion following Proposition to the representations ... to the proof of Lemma Since the lemma is evidently independent of the choice of the character ψ, we will suppress it from the notation 3.4 Representations of G-type Let σ be a self -dual square-integrable...

Ngày tải lên: 22/03/2014, 15:21

... are shown at the side of the panel (B) MS analysis of LGOX Upper panel, LGOX precursor; middle panel, a-fragment; lower panel, b-fragment and c-fragment mass of approximately 41 700 Da (Fig 1B), ... the detailed molecular characteristics associated with the unique properties of LGOX Experimental procedures Protein purification The LGOX precursor was purified from the cell lysate of E coli JM109 ... structural study of PAO also revealed a U-shaped funnel, which is more complicated than that of LAAO [21] The LGOX funnel shape and length resemble those of ˚ PAO (30 A) (Fig 4A) However, the comparison...

Ngày tải lên: 23/03/2014, 05:22

... its covalent coupling to poly(ethylene glycol) [19–21] Unfortunately, naturally available enzymes are usually not optimally suited for therapeutic purposes This incompatibility often relates to ... competent BL21(DE3)pLysS E coli cells E coli cells, harbouring plasmids pT7MutASNase, were grown at 37 °C in 30 mL of Luria–Bertani medium containing 100 lgÆmL)1 ampicillin and 34 lgÆmL)1 chloramphenicol ... structural flexibility, we analysed the plots of the crystallographic B-factors along the polypeptide chain of the enzyme structure This plot can give an indication of the relative flexibility of portions...

Ngày tải lên: 30/03/2014, 02:20

... -ICVTSANAPKIIKK LEAKKIVFLPDQALGNWVAKQV -LVLLPD-LEAGCSLADSCPPREFAEFKQRHPDHL -VISYINCTAEIKALSD -IICTSSNAVKIVQQ -LPPDQKIIFAPDRNLGRYVMEQTGR -LVLLPD-LEAGCSLADSCPPREFAEFKQRHPDHL -VISYINCTAEIKALSD ... MSVMFDPDTAIYPFPPKPTPLSIDEKAYYREKIKRLLKERNAVMVAHYYTDPEIQQLAEETGGCI -SDSLEMARFGAKHP -ASTLLVAGVRFMGETAKILSPEK -MSVMFDPQAAIYPFPPKPTPLNDDEKQFYREKIKRLLKERNAVMVAHYYTDPEIQQLAEETGGCI -SDSLEMARFGTKHA ... -EITLPEATMAAALKPIQ FLALPTVSG -CACNECPHMRLNTLEKLYLAMKTRSP -QIEIPESILLNAKKPIE FYIVKTSDSG -G-CVSCSKCPHMRLNTLEKLYLCLKNGYP -EITLDPEISSMAKRSLD...

Ngày tải lên: 30/03/2014, 02:20

... PsLADH L- Lactaldehyde Coenzyme Substrate b D-Lactaldehyde b Glycolaldehydec PsALDH* L- Lactaldehyde b D-Lactaldehyde AvLADH EcLADHd b Glycolaldehydec b L- Lactaldehyde b D-Lactaldehyde Glycolaldehydec ... with l- lactaldehyde Overall, the specificity for l- lactaldehyde of PsLADH was significantly higher than that of PsALDH*, conforming to the physiological role as a LADH involved in the alternative l- rhamnose ... Aspergillus nidulans Aspergillus niger Ustilago maydis Pichia angusta FTDH HMSALDH ScALDH4 PsLADH ScALDH5 ScALDH6 ScALDH2 ScALDH3 PsALDH* Group X Class 1/2 branch Class branch BALDH SSALDH EcLADH...

Ngày tải lên: 30/03/2014, 02:20

... cleaved PCR products was performed on 3130 Genetic Analyzer (Applied Biosystems, USA) using POP7 polymer (Applied Biosystems, USA) Analyses of PCR products were done by GeneMapper (Applied Biosystems, ... 2A) The influence of selected cell line on replication efficiency of viral clones and thus a genetic heterogeneity of the entire viral sample was also reported previously [20] Page of (page number ... SD of four independent PCR-RFLP experiments A limited number of serial passages of L- Zagreb vaccine strain in Vero and SH-SY5Y cell line further confirmed the influence of the cell culture selection...

Ngày tải lên: 20/06/2014, 01:20

... solution was formed by mixing 250 lL Fe3O4 nanoparticles suspension and mL phosphate-buffered saline (PBS) Then, 10 lL of anti-CAP monoclonal antibody and mg of 1-ethyl-3-(dimethylaminopropyl) ... 10.1021/jp80163 2p 38 C.C Pamela, A.H Richard, R.F Denise, Lippincotts Illustrated Reviews: Biochemistry (Lippincott Williams & Wilkins, Philadelphia, 2008) 39 W Temesghen, P. M.A Sherwood, Anal Bioanal ... that L- arginine-capped Fe3O4 nanoparticles were successfully attached to the anti-CAP monoclonal antibody Conclusions We have synthesized L- arginine-capped superparamagnetic Fe3O4 nanoparticles...

Ngày tải lên: 22/06/2014, 00:20

... well defined Usually in application property, (B) will mean that the map is compact with convex compact values Other examples of maps with a well-defined fixed point index (e.g., property (B) could ... [11] R P Agarwal and D O’Regan, “A generalization of the Petryshyn-Leggett-Williams fixed point theorem with applications to integral inclusions,” Applied Mathematics and Computation, vol 123, ... Avery and A C Peterson, “Multiple positive solutions of a discrete second order conjugate problem,” PanAmerican Mathematical Journal, vol 8, no 3, pp 1–12, 1998 Richard Avery: College of Arts and...

Ngày tải lên: 22/06/2014, 06:20

... well defined Usually in application property, (B) will mean that the map is compact with convex compact values Other examples of maps with a well-defined fixed point index (e.g., property (B) could ... [11] R P Agarwal and D O’Regan, “A generalization of the Petryshyn-Leggett-Williams fixed point theorem with applications to integral inclusions,” Applied Mathematics and Computation, vol 123, ... Avery and A C Peterson, “Multiple positive solutions of a discrete second order conjugate problem,” PanAmerican Mathematical Journal, vol 8, no 3, pp 1–12, 1998 Richard Avery: College of Arts and...

Ngày tải lên: 22/06/2014, 19:20

... for all s ∈ U F is said to be lower semicontinuous if it is so at each point of S The following well-known results will be our main tools Theorem [3] Let X be a paracompact topological space ... subset of E Likewise, essentially the same proof gives the following version of Theorem 1, for r = ∞ Theorem Let X be a paracompact topological space, Y a real Banach space, and A : X → Y ∗ an operator ... topology of E, all the assumptions of Theorem are satisfied and the conclusion follows from it Remark 13 Observe that when X is first-countable, the local boundedness of A follows automatically from...

Ngày tải lên: 23/06/2014, 00:20

... Saturation of Hb 0.98 0.73 Hb-bound O 197 mL /L 147 mL /L Dissolved O2 2.7 mL /L 1.2 mL /L Total O2 content 200 mL /L 148 mL /L Blood volume † 1.25 L 3.75 L Volume of O 250 mL 555 mL *Values shown ... that opposes nonpulsatile flow, while impedance opposes pulsatile flow, arterial resistance may play a minor role in the impedance to ventricular emptying Arterial resistance can, however, influence ... amount of glucose and oxygen in blood in P. 25 millimoles (mmol) (The values shown here are based on a blood glucose level of 90 mg/dL or 90/180 = 0.5 mmol/dL, a blood volume of liters, and a total...

Ngày tải lên: 28/06/2014, 23:20

... effects of agricultural practices on arbuscular mycorrhizal fungi 89 BURGHARDT,W Soil sealing and soil properties related to sealing 117 WELLS, E C Cultural soilscapes 125 LANDA, E R From agricultural ... about 2000 of the Fellowship carry the title (CGeol) Chartered Geologists may also obtain the equivalent European title, European Geologist (EurGeol) One fifth of the Society's fellowship resides ... MONTANARELLA ,L Policies for a sustainable use of soil resources 149 INACIO, M., PEREIRA, V & PINTO, M Assessing anthropogenic inputs to soils by comparing element contents and their spatial distribution...

Ngày tải lên: 06/07/2014, 08:20

Ngày tải lên: 05/08/2014, 10:20

Ngày tải lên: 05/08/2014, 15:21