... relational database This model forms a basis fora hierarchical data model and for temporal access control algorithms to allow VCR-like capabilities They show how it can be mapped to a relational ... media, and (Gibbs et al 1993) deals with so-called audio/video (AV) databases These databases are collections of digital audio/video data and processes which can 37 compose and aggregate these data ... object-oriented database in later stages of this research This will enable us to take advantage of advanced features like temporal models that are fundamental for multimedia applications It is hoped that one...
... blocks of arbitrary size Like RAID-3, it has a disk array to store the file data and puts the parity data on a separate parity disk Unlike RAID-3 with parallel read/write per operation, RAID-4 accesses ... on the availability wastes too much because the whole disk array has two identical parts Mirroring is frequently used in database applications where availability and transaction rate are more ... mode data=journal provides full data and metadata journaling It ensures the consistency of data and its metadata To evaluate what kind of benefits or costs the parallel access brings to us, we also...
... space fora small amount of data, the remaining fragments of the block are made available for allocation to other files As an example consider an 11000 byte file stored on a 4096/1024 byte file system ... fragments and a single unused fragment This remaining fragment can be allocated to another file as needed Space is allocated to a file when a program does a write system call Each time data is written ... the allocated space The problem with expanding a file one fragment at aa time is that data may be copied many times as a fragmented block expands to a full block Fragment reallocation can be minimized...
... Geographic Information system (GIS) is any system integrates hardware, software, and data for capturing, managing, analyzing, and displaying all forms of geographically referenced information ... applications today use Relational Database Management System (RDBMS) using Structure Query Language (SQL) to store and manipulate data logic There are many available options to implement data ... 2.3.2.3 Data access tier It consists of the database server that contains all logic data of application Separating logic data from application into it will make program scalable and higher performance...
... the pollutants concentration was low in the rain season (from May to October) The data from the local weather station showed that the average annual rainfall and evaporation was 802mm and 2093mm, ... order to make full use of the land advantage to strengthen ecological and scenical effect of ecological system The area was 2000 m2 and hydraulic loading rate was 4cm/d in the free-surface constructed ... domestic wastewater in Lake Dianchi Valley., Proceedings of Asian waterqual’2003, IWA Asia-Pacific Regional conference, Abstract on pp 70, Paper on CD-ROM, Bangkok Liu, C.X., Hu, H.-Y., Huang, X.,...
... provides practical information with reasonable accuracy, which can be used for environmental planning and management Open land use corresponds to low pollutant loads for all water quality parameters ... loading areas, which were classified as public land use in the SCAG data and USGS classification system Recreational facilities including parks were also classified as low pollutant loading areas, ... pollutant loads per unit pixel and unit rainfall for each water quality parameter i and α is a normalization factor that depends on units and conversion factors Table Runoff coefficient and EMCs for...
... medical domain FEATURES EXTRACTION AND CASE FORMULATION Extracting appropriate features is of great importance in performing accurate classification in a computer-aided system whereas in manual ... the maximum feature value fora feature f between the whole case base and a query case C and Min retrieves the minimum feature value fora feature f between the whole case base and a query case ... features are extracted automatically from the fifteen minutes (1800 samples) FT measurements signal data Then a new case is formulated with 19 features as a total keeping in a vector above 12 features...
... translated in a full knowledge of the building graph and a calculation of the shortest paths by using Dijkstra’s algorithm An evacuee becomes aware of a hazardous area when it reaches a location ... hazard A low value indicates that the system has succeeded in directing the evacuees along safe paths, avoiding the hazardous locations • Percentage of fatally injured evacuees This is a straightforward ... building’s structure before the hazard starts spreading We consider that the evacuees are familiar with all the available exits and are able to follow the shortest paths that lead to them In terms...
... Analysis with Spreadsheets Duxbury Press, Belmont, CA Kleinmuntz, C.E., Kleinmuntz, D.N., 1999 A strategic approach to allocating capital in healthcare organizations Healthcare Financial Management, ... multicriteria value analysis and decision conferencing: A case study International Transactions in Operational Research, 13(4), 279-297 Bana e Costa, C .A. , Lourenço, J.C., Soares, J.O., 2007 An interval ... References Bana e Costa, C .A. , 1990 An additive value function technique with a fuzzy outranking relation for dealing with poor intercriteria preference information In C .A Bana e Costa, ed Readings...
... growing rapidly AMR Research, an authoritative market forecast institution in America, indicated that the ERP market would grow at annual rate of 37% in recent years The sales of the ERP packaged ... cooperative working platform, knowledge transfer platform, individual RESEARCH PAPER KM platform, organizational KM platform and consulting platform The interplay of these five platforms can speed ... classification is widely cited Explicit knowledge is transmittable in formal, systematic way It can be processed by a computer, transmitted electronically or stored in a database (Nonaka and Takenchi,...
... etc A QC can be mathematically defined as a random variable, which is a function that takes values from a population or distribution Denote a QC as random variable x If a population Ω only contains ... variation change Notice that SPC charts are designed to detect assignable causes of variation as indicated by mean or standard deviation shifts and at the same time tolerate the chance variation ... statistical control charts for monitoring process variance changes Johnson and Leone (196 2a, 1962b) and Page (1963) later proposed CUSUM charts based on sample variance and sample range As an alternative,...
... manager insisted on it As a supervisor, Ryan now had to give in-person reports to top management on a regular basis Every time his manager asked for an advance look at Ryan’s presentation, Ryan ... before the event My husband, David, is a bass player Back in the mid-’80s, he was playing a benefit to save Broadway theaters, which were then being demolished at an alarming rate As he was waiting ... people has taught me never to assume that simply acquiring or refining a particular skill will mean that all is immediately and always well Using what you’ve learned about yourself so far as a guide...
... and examination, and all the biochemical, radiological and cardiological investigations are readily available in all clinical settings This means that, with practice, both scores can be gauged ... the porta hepatis Discussion As far as we are aware, this is the first case of classical hepatocellular carcinoma occurring in a cirrhotic liver A 39-year-old male Caucasian cabinet-maker presented ... et at 56 46 t Discussion Surgical audit has increased in importance over the past few years, both as an educational process and as a means of assessing the quality of surgical care We felt that...
... 277 283 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK *****::*.** : ... Toyobo (Osaka, Japan) Emulgen 911 was a gift from Kao Chemical (Tokyo, Japan) NADPH, NADH and NADP+ were purchased from Oriental Yeast (Tokyo, Japan) a- Cyano-4-hydroxycinnamic acid was obtained from ... :.:: : * : * NAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKA-EFQGK-RVLIVGGGDS -EYTCDALIIATGASA -RYLGLPSEEAFKGRGVSACATCDG-FFYRNQKVAVIGGGNT LEVKARTVILAVGSRR -RKLGVPGEAELAGRGVSYCSVCDAPLFKGKDAVVVVGGGDS...
... We also integrate the sentiment-detection system with a real-time rule-based harmonic music and animation generator to display streams of messages in an audiovisual format Conceptually, our system ... similar to what many people have proposed for evaluation (Davidov et al 2010; Sun et al 2010; Bifet and Frank 2010; Go et al 2009; Pak and Paroubek 2010; Chen et al 2010) We use data from January ... playing Animation Generation In this final stage, our system produces real-time animation for visualization The streams of messages are designed to flow as if they were playing a piece of a piano...
... tool for speech research For example, the MT Voice Recorder offers useful features for language documentation An immediate warning about a poor quality recording will alert a researcher to rerecord ... wants to be synthesized clearly and will automatically be included in their entirety in the speech database These utterances are also automatically labeled before being stored In addition, for ... Other Applications Although the MTVR was designed specifically to record speech for the creation of a database that will be used in speech synthesis, it can also be used as a digital audio recording...
... Miroslav Melichar, and Martin Rajman 2005 A Framework for Rapid Multimodal Application Design In V´ clav Matouˇek, Pavel Mautner, a s and Tom´ s Pavelka, editors, Proceedings of the 8th a International ... can compare if the enforcement of certain modalities has an impact on how they choose to use language when all modalities are available On the backend, the wizards can also to some extent have ... the system in the form of sets of semantic pairs A semantic pair (SP) is a qualified piece of information that the dia50 logue system is able to understand For example, asystem could understand...
... develop a knowledge representation of a conceptualization of an object, that is, a representation of the way an object can be conceptualized, given a particular language, a particular situation, ... between a point and a line IN/DANS: • relation between a point and a bounded surface • relation between a point and an empty volume • relation between a point and a full volume ~ Our next task was ... the target-language conceptualization, the system derives the preposition to be used in the target-language sentence appropriate for expressing a relation between a point and a surface, and French...
... is that when they are formulated loosely, as in the previous paragraph, they appear to conflict In particular, in ( 2a) , Right Association seems to call for the parse that makes for Mary a modifier ... Systems, ed P Jacobs, Lawrence Erlbaum Associates, Hillsdale, NJ, pp 13-33 Kameyama, M (1992) "The Syntax and Semantics of the Japanese Language Engine", forthcoming In Mazuka, R., and N Nagai, ... the fact that every lexical item has a semantics associated with it Table contains average edge counts and parse timing statistics for the 5875-utterance training set Many systems (Carbonell and...
... (216(3), USA ed., March 1994): 59 4) In the far reaches of her mind, Anne knew Kyle was haying an affair, but "to acknowledge the betrayal would mean I'd have to take a stand." We suggest that a likely ... a reasoning system ATT-Meta (Barnden & Lee 1999) is a preexisting approach and implemented systemfor metaphorical reasoning The system is rule based and carries out reasoning with uncertainty ... classification of an event, as, for example eat (mary, bread) , and event rate is relative to event type as well as the specific event Logical forms for other VNMAs have been developed along similar...