reading a document type definition

... #REQUIRED> File XML viết sau hợp quy tắc: < XXX> Ví dụ3: Giả sử có file att.dtd với nội dung sau: ...

Ngày tải lên: 29/09/2013, 03:20

... means “character data,” and may take any literal string as a value 19 The Format of an Attribute Definition • -type defaultvalue> • The default value is given ... finite-state automaton • Let’s start with a simpler example: name, addr*, email addr name A double circle denotes an accepting state email This suggests a simple parsing program 15 Another Example name,address*,(tel ... (#PCDATA)> The dimension attribute is required The accuracy attribute is optional CDATA is the type of the attribute – it means...

Ngày tải lên: 24/10/2014, 12:31

... more than 30 research projects on solar radiation and solar thermal technology funded by national and international organizations As a result, he has published more than 50 original research papers ... vegetables per batch As Thailand is situated in the tropics, the rainy season lasts approximately six months Apart from high loading capacity, the dryer has to be equipped with an auxiliary heater ... for evaluation of the colour of dried food materials The instrument was standardised each time with a white ceramic plate Three readings were taken at each place on the surface of samples and then...

Ngày tải lên: 05/09/2013, 16:10

... collect information to make an informed decision about the type of motorcycle that will attract new riders After you collect and analyze the information, you will be able to develop a design First, ... identify a spokesperson who can present the group’s ideas in a class discussion Brainstorm about your answers and present them in any format that will communicate them most effectively For example, ... Provide at least three sources from which you can try to obtain information Be specific If you want to interview a person, specify their job or characteristics Indicate at least two questions that...

Ngày tải lên: 17/01/2014, 09:20

... System.Data.SqlClient.SqlDataAdapter(); mySqlDataAdapter.SelectCommand = mySqlCommand; MyDataSet myDataSet = new MyDataSet(); sqlConnection1.Open(); mySqlDataAdapter.Fill(myDataSet, "Customers"); sqlConnection1.Close(); ... MyDataSet.CustomersDataTable myDataTable = myDataSet.Customers; foreach (MyDataSet.CustomersRow myDataRow in myDataTable.Rows) { listView1.Items.Add(myDataRow.CustomerID); listView1.Items.Add(myDataRow.CompanyName); ... Using a Strongly Typed DataSet Class Once you have your strongly typed MyDataSet class, you can create an object of that class using the following code: MyDataSet myDataSet = new MyDataSet();...

Ngày tải lên: 21/01/2014, 07:20

... siderophore characterization 32 Umezawa H, Aoyagi T, Ogawa K, Obata T, Iinuma H, Naganawa H, Hamada M & Takeuchi T (1985) Foroxymithine, a new inhibitor of angiotensin-converting enzyme, produced by actinomycetes ... producing bacterium Saccharopolyspora erythraea NRRL23338 Nat Biotechnol 25, 447–453 Oliveira PH, Batagov A, Ward J, Baganz F & Krabben P (2006) Identification of erythrobactin, a hydroxamatetype siderophore ... detection and isolation of NRPs [20] Furthermore, this approach substitutes the CAS assay-guided fractionation and enabled the scale-down of NRP discovery from a preparative to analytical scale In addition,...

Ngày tải lên: 16/02/2014, 09:20

... 4,6-disubstituted-HexN and, in small amounts, terminal-Rha and 6-substituted-Glc In addition, the disaccharide 7-O-carbamoyl-Hep-(1fi3)Hep was found Fatty acid analysis revealed the presence of typical fatty acids ... oligosaccharides from Pseudomonas strains have already been isolated and characterized [12,13], mainly from Pseudomonas aeruginosa strains [21,37–43] The carbohydrate backbone of the so-called ... chromatography, which was purified further and the resulting oligosaccharide (Fig 6) analyzed by compositional/methylation analyses, 2D NMR and mass spectrometry Compositional and methylation analyses...

Ngày tải lên: 19/02/2014, 13:20

... side-chain at residue 210 is dispensable, as shown by the fact that H21 0A and H210S are as active as native API with VLK-MCA as a substrate (Table 1) This means that Trp169 does not play a role as an ... importance of the aspartate in the catalytic triad is not fully understood because several serine proteases not have an aspartate as the catalytic apparatus M NaCl However, for chymotrypsin -type ... Asp113 and His210, rather than a catalytic triad ACKNOWLEDGEMENT We are grateful to Dr T Yamazaki for NMR measurements, Y Yagi for the amino acid analysis, and Y Yoshimura for the sequence analysis...

Ngày tải lên: 21/02/2014, 03:20

... Biolabs After PCR amplification, pknA was treated with Klenow, and the blunt-ended fragment was cloned at the SmaI site of pUC19 (pPknA) Plasmid DNA was prepared after transformation of pPknA in ... TGAGCCCCCGAGTTGG-3¢), CC62 (5¢-GTGTTGCGG TGAATGTGCTCAAGAGCG-3¢) and two reverse primers, CC61 (5¢-CTGCCCGGTGGGGGTGATCAAGA TG-3¢), CC63 (5¢-CGCTCTTGAGCACATTCACCGCA ACAC-3¢), were synthesized Base ... an additional 20 s in each cycle) PCR was also used to generate the K42N (replacement of lysine by asparagine at residue 42) point mutant of PknA Two forward primers, CC58 (5¢-CACAGGAATTCCATA...

Ngày tải lên: 22/02/2014, 04:20

... 36 Hakamada, Y., Endo, K., Takizawa, S., Kobayashi, T., Shirai, T., Yamane, T & Ito, S (2002) Enzymatic properties, crystallization, and deduced amino acid sequence of an alkaline endoglucanase ... 19–25 27 Altschul, S., Madden, T.L., Schaffer, A. A., Zhang, J., Zhang, Z., Miller, W & Lipman, D.J (1997) Gapped-BLAST and PSIBLAST: a new generation of protein database search programs Nucl Acids ... purification and characterization of Paenibacillus sp BP-23 cellobiohydrolase Cel48C, a unique type of cellulase among Bacillales, bearing a multidomain structure and showing the properties of a processive...

Ngày tải lên: 08/03/2014, 02:21

... GMAC® For permission contact the GMAC® legal department at legal@gmac.com Creating Access to Graduate Business Education®, Global MBA®, GMAC®, GMAT®, Graduate Management Admission Council®, and ... “Work-Life Balance: An MBA Alumni Report.” Graduate Management Admission Council® Available at http://www.gmac.com/gmac/ResearchandTrends/Tools/RR0509_WorkLifeBalance.htm Schoenfeld, G and G Bruce ... a meta-analysis by harvesting alpha coefficients from a census of eight leading psychology and marketing-related journals and a convenience sample of sixteen other journals A total of 4,286 alpha...

Ngày tải lên: 08/03/2014, 02:21

... past and future), mood (indicative and imperative), and voice (active and passive) As concerns notation, usually several kinds of information are collapsed in a single abbreviation, cf K standing ... plural masculine nouns the difference in animateness is present, due to grammatical agreement, also with verbs and adjectives in the above mentioned way, and because in technical texts substantially ... be analyzed (which seems to be an easier task with geograohical names, of Evrooa (Zuro~e), rraha ~Prague), etc.) On thl~ solution, oT'o'r"~xample, the accusative form of ~raha (F), namely Prahu,...

Ngày tải lên: 09/03/2014, 01:20

... appropriate primers (Pf LDH: forward 5¢-ATGGCACCAAAAGCAAAAATCG-3¢ and reverse 5¢-AGCTAATGCCTTCATTCTCTTAG-3¢; Pf MQO forward 5¢-ATGATATGTGTTAAAAATATTTTG-3¢ and reverse 5¢-TCATAAATAATTAACGGGATATTCG-3¢) ... LEIVNLHA—-SPYVAPAAAIIEMAESYLKDLKKVLICSTLLE-G-QYGHSD-IFGGTPVV AEIIKLAK-ASAAFAPAAAITKMIKSYLYNENNLFTCAVYLN-G-HYNCSN-LFVGSTAK GEIVKLLKTGSAYYAPAASAIAMLESYLKDKRQILTCAAYLQ-G-EYDIHD-LYIGVPII AEIVGLLKTGSAYYAPAASAIEMAESYLKDKKRVLPCAAHLS-G-QYGVKD-MYVGVPTV ... Preparation of pure and intact Plasmodium falciparum plasma membrane vesicles and partial characterization of the plasma membrane ATPase Malar J 1, 1–7 28 Bradford, M.M (1976) A rapid and sensitive...

Ngày tải lên: 16/03/2014, 18:20

... 5’-CCGCTCGAGTTAGTCAATCCCAATTTCAGC-3’ 5’-CGCGAATTCCGCAAGATATCGGATTAGGAA-3’ 5’-CGCGGATCCCTTGCCGATTTGGATCATTC-3’ 5’-GCTCTAGAATCTACAAACCTAAAACAAC-3’ 5’-TGCCCGCGGTCATAATATCACGGACCGCAT-3’ 5’-CGCGGATCCGAAAATTTGTTTGATTTTTAA-3’ ... CAT1 CAT2 PRTI PRT-F PRT-R SX KRT-F KRT-R Cp 5’-AGGATGCCATATGATCCAAATCGGCAA-3’ 5’-TTGATTATGAATTCGCTTTTAAGGAGTAGC-3’ 5’-GTAGGACAGAATTCAAGACAAGTCTACATACA-3’ 5’-TCCTCAGTACTCTCCACTGCCACT-3’ 5’-GGATGCACCATGGTCCAAATCGGC-3’ ... 5’-GGATGCACCATGGTCCAAATCGGC-3’ 5’-GGACTGACATATGGAAATTTCATTA-3’ 5’-CTTGCGAATTCGGATCATTCTGCATCC-3’ 5’-CTCGATAGTGCCGGCTTGACC-3’ 5’-GCAGGAGGCCTAGCCAACATT-3’ 5’-GAACTGACATATGGGTAAATATTTTGGG-3’ 5’-CCGCTCGAGTTAGTCAATCCCAATTTCAGC-3’...

Ngày tải lên: 16/03/2014, 18:20

... be made clear below 4.1 (Almost) Automatic Synset Identification One of the advantages of using biblical literature is the availability of a great deal of manual annotation In particular, we are ... minḥâh and nā a tend to be located in the same units and, concomitantly, miqṣ a , tĕrûmâh and šāṯal are located in the same units Conveniently, the former are all Jeremiah and the latter are all ... in each case the vast majority of verses are correctly assigned and only a small fraction are incorrectly assigned That is, we can tease apart the components almost perfectly Figure Percentage...

Ngày tải lên: 17/03/2014, 00:20

... or [AB87] 2.1 Real trees An arc in a topological space is a subspace homeomorphic to a compact interval in R A point is a degenerate arc A real tree is a metric space with the property that any ... is a lift Ak of Ak that terminates at y For infinitely many k, Ak starts at x, and {Ak } forms a polynomial sequence Therefore, for all large k, Ak starts at x Suppose next that the last operation ... universal cover of a marked real graph has a structure of a real free Fn -tree that is well-defined up to equivariant isometry A real Fn -tree T admits an Fn -equivariant map µ : Rosen → T This map...

Ngày tải lên: 22/03/2014, 20:20

... knockouts, and comparison with in vivo viability data from the Keio collection Deficiency AccACD CdsA Cls FabA FabB FabD FabF FabG FabH FabI FabZ GpsA GutQ KdsA KdsB KdsC KdsD Lipid A Lipid A (ca) x ... GpsA J_(10s-14s)_to_(12u-16u) J_(10u-14u)_to_(12u-16u) AccA, AccC, AccD FabB_2, FabF_2 GpsA_1, GpsA_2 FabF_1, FabB_4, FabG_2 FabB_1, FabG_1, FabZ_1, FabA_3, FabI_1 FabF_1, FabB_4, FabG_2, FabZ_2, ... that E coli has a very complex metabolism An earlier metabolic pathway analysis of amino acid metabolism in E coli was also indicative of high redundancy [49] For analysis of robustness, rather...

Ngày tải lên: 22/03/2014, 21:20

... Coomassie Brilliant Blue (A) and the other was stained for activity using a- naphtyl acetate after renaturation (B) Lane M relative molecular mass standards; lane 1, cell free extract; lane 2, heat-stable ... 5¢-CA FEBS Journal 274 (2007) 2832–2842 ª 2007 The Authors Journal compilation ª 2007 FEBS M Levisson et al GTCACCTGGTAGTTACTGCCGCCGAAG-3¢, 5¢-CGAC GATCTCAATAACTTGATGATTTCAGG-3¢ and 5¢-CTC CTGAAATCATCAAGTTATTGAGATCGTCG-3¢, ... et al (2005) CDD: a Conserved Domain Database for protein classification Nucl Acids Res 33, 192–196 34 Kanehisa M, Goto S, Kawashima S & Nakaya A (2002) The KEGG databases at GenomeNet Nucl Acids...

Ngày tải lên: 23/03/2014, 09:20

... could activate adenylcyclase and thus increase cellular cAMP levels and native PKA activity On the other hand, HIP/PAP via its interaction with RIIa might impair the association of PKA catalytic ... Hepatocarcinoma-intestine-pancreas/pancreatic associated protein (HIP/PAP) is expressed and secreted by proliferating ductules as well as by hepatocarcinoma and cholangiocarcinoma cells Am J Pathol ... heart PKA The sense primer (5¢-GTCGAATTCCAAGGTG AAGAACCCCAG-3¢) was located at nucleotides 63–90 of the coding sequence, and the antisense primer (5¢-TG CTGAATTCCCTCCCTCCTGCACTAGTCAG-3¢) overlapped...

Ngày tải lên: 23/03/2014, 13:20

... Structures of decasaccharide and tridecasaccharide tetraphosphates isolated by strong alkaline degradation of O-deacylated lipopolysaccharide of Pseudomonas fluorescens strain ATCC 49271 Carbohydr Res ... (HPAEC) on a semipreparative CarboPac PA1 column (250 · mm; Dionex, Sunnyvale, CA, USA) using a linear gradient of 0.02–0.6 M NaOAc in 0.1 M NaOH at a flow rate of mLÆmin)1 for 100 and 2-mL fractions ... 2-propanol, water, and triethylamine mixture and sprayed at a flow rate of lLÆmin)1 Capillary entrance voltage was set to 3.8 kV, and dry gas temperature to 150 °C Capillary skimmer dissociation...

Ngày tải lên: 23/03/2014, 13:20