placement of the button instance for a keypress event just off the stage
Báo cáo Y học: Modeling the three-dimensional structure of H+-ATPase of Neurospora crassa Proposal for a proton pathway from the analysis of internal cavities pptx
Ngày tải lên :
23/03/2014, 21:20
... enzymes for which structural data are available MATERIALS AND METHODS Building the 3D model of PMA1_NEUCR In our approach, the model of PMA1_NEUCR was built using the ATC1_RABIT crystal structure as ... Val334, and Val336 on M4 and Ala726 and Asp730 on M6 Alanine-scanning mutagenesis along segment M4 of yeast H+-ATPase showed that replacement of Ile331 and Val334 had little or no effect on ATP-dependent ... horizontal black lines delineate the approximate membrane position The catalytic Asp (Asp378) appears in red defective in the E1-E2 conformational change Here, the Val336Ala mutant displayed kinetic...
- 13
- 514
- 0
SIMULATION AND VERIFICATION OF PARTICLE COAGULATION DYNAMICS FOR A PULSED INPUT
Ngày tải lên :
05/09/2013, 08:40
... porous and fractal (Jiang and Logan, 1991) The relationship between the mass and the size of a fractal aggregate can be written as m∝lD, where l is the actual length of the aggregate and D is the ... the fractal dimension A fractal aggregate with D
- 6
- 509
- 0
Báo cáo hóa học: " Optimization of capsid-incorporated antigens for a novel adenovirus vaccine approach" doc
Ngày tải lên :
20/06/2014, 01:20
... NSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAA SGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ SNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEK GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ ... FACSCalibur (Becton Dickinson, Franklin Lakes, NJ) and data were analyzed with FlowJo (Ashland, OR) software Statistical evaluation The data are presented as the mean ± the standard error Statistical ... CGGGATCCCGGTTTCTTCTGAGGCTTCTCG CGGGATCCGGTGGCGCAGGCGG 83RGD -(as) 83RGD - (a) CGGGATCCCAGGGGTTTGATCACCGGTTT CGGGATCCACCGAACAGGGCGGGG 3'HVR5-(as) 5'HVR2-(s) GGCATGTAAGAAATATGAGTGTCTGGG CTCACGTATTTGGGCAGGCGCC a antisense,...
- 13
- 419
- 0
báo cáo hóa học:" Research Article Strong Convergence Theorems of Viscosity Iterative Methods for a Countable Family of Strict Pseudo-contractions in Banach Spaces" pot
Ngày tải lên :
21/06/2014, 11:20
... K Aoyama, Y Kimura, W Takahashi, and M Toyoda, “Approximation of common fixed points of a countable family of nonexpansive mappings in a Banach space,” Nonlinear Analysis: Theory, Methods & Applications, ... initiated the study of certain classes of nonlinear operators by means of the duality mapping Jϕ Following Browder 23 , we say that a Banach space E has a weakly continuous duality mapping if there ... inequality and the proof of the second part can be found in 24 Lemma 2.8 see 24 Assume that a Banach space E has a weakly continuous duality mapping Jϕ with gauge ϕ i For all x, y ∈ E, the following...
- 21
- 379
- 0
Báo cáo hóa học: "Research Article Strong Convergence Theorems of Common Fixed Points for a Family of Quasi-φ-Nonexpansive Mappings" ppt
Ngày tải lên :
21/06/2014, 20:20
... resolvents of accretive operators in Banach spaces,” Journal of Mathematical Analysis and Applications, vol 75, no 1, pp 287–292, 1980 B Halpern, “Fixed points of nonexpanding maps,” Bulletin of the American ... in an iterative method for nonexpansive mappings,” Bulletin of the Australian Mathematical Society, vol 65, no 1, pp 109–113, 2002 Y Kimura and W Takahashi, “On a hybrid method for a family of ... relatively nonexpansive mappings in a Banach space,” Journal of Mathematical Analysis and Applications, vol 357, no 2, pp 356–363, 2009 G Lewicki and G Marino, “On some algorithms in Banach spaces...
- 11
- 270
- 0
Báo cáo hóa học: " Research Article A Refinement of Jensen’s Inequality for a Class of Increasing and Concave Functions" pptx
Ngày tải lên :
22/06/2014, 03:20
... > We now make some remarks about Theorem 1.2 10 Journal of Inequalities and Applications Remark 1.5 For part a of the theorem, we can chose a smaller value, −u/ 2f a , for μ1 than that in 1.4 ... complete the proof for part a of Theorem 1.2 by showing the following lemma 8 Journal of Inequalities and Applications Lemma 1.3 For any integer n ≥ 1, and for all x1 , , xn with each xk ∈ a, b and ... nondecreasing function of x, and achieves its maximum at x b Hence, π2 max − x∈ a, b f x −f a x a f x − f b −f a b a f b eb a − b a is a 2.13 Lemma 2.7 For < b − a < 2, eb a − ≥ 2− b a b a 2.14 Proof...
- 14
- 373
- 0
Báo cáo y học: "Ultrasound guided injection of dexamethasone versus placebo for treatment of plantar fasciitis: protocol for a randomised controlled trial" potx
Ngày tải lên :
10/08/2014, 21:24
... medial calcaneal tubercle and/or the proximal plantar fascia To confirm the diagnosis of plantar fasciitis, the dorso-plantar thickness of the plantar fascia will be measured by ultrasound at a ... Participants treated for bilateral plantar fasciitis will have thickness measurements taken for each individual foot However, for bilateral cases, the mean change in plantar fascia thickness for ... by the Australian Podiatry Education and Research Foundation (APERF) AMM is currently an Australian Postgraduate Award scholarship holder HBM is currently a National Health and Medical Research...
- 8
- 352
- 0
Leaders of change companies prepare for a stronger future
Ngày tải lên :
06/12/2015, 23:04
... record and sustainability performance as a sales draw “We realised that we had an advantage and needed to sell it,” he says “Sales and marketing is being affected the most.” Sales and marketing ... real change than management on the cost side The customer base has changed; the world has changed People realise that they need to change their sales and marketing approach.” Broad organisational ... that goes on periodically” Large organisations add on layers and roles—particularly in good times—and then need to shed them Mr Tartaglia of Allianz says, “I’ve yet to embark on a change initiative...
- 21
- 149
- 0
A comparison of different regularization methods for a Cauchy problem in anisotropic heat conduction
Ngày tải lên :
16/06/2016, 01:11
... other hand, specific regularization methods can be developed for particular problems in order to make use of the maximum amount of information available The use of any extra information available ... way of dealing with the anisotropicity is to transform the governing partial differential equation (1) into its canonical form by changing the spatial coordinates However, after the transformation, ... F03AAF (NAG Fortran Library Manual, 1991), which evaluates the determinant of a matrix using the Crout factorisation method with partial pivoting The condition number of the system of equation...
- 19
- 347
- 0
Training for a 10k Event By Ben Wisbey doc
Ngày tải lên :
23/03/2014, 13:20
... minimise fatigue during the event Although these characteristics are the primary focus, approximately 15-20% of energy for the 10km is produced anaerobically Therefore the anaerobic system also needs ... sessions There are other important aspects of performance Remember to follow a sensible nutritional plan, from day to day, and pre and post training Stretching is also an essential aspect of training ... improving aerobic endurance, strength and fatigue resistance This run should ideally be completed over natural undulating terrain and at a moderate/comfortable intensity for the duration of the run...
- 6
- 456
- 0
báo cáo hóa học:" Research Article Bifurcation Analysis for a Delayed Predator-Prey System with Stage Structure" pdf
Ngày tải lên :
21/06/2014, 11:20
... Biomathematics, pp 253–257, World Scientific, River Edge, NJ, USA, 1997 Y N Xiao and L S Chen, “Global stability of a predator-prey system with stage structure for the predator,” Acta Mathematica ... rate of the predator Therefore, more realistic models of population interactions should take into account the effect of time delays So, we introduce the delay τ due to gestation of mature predator ... we can obtain the following theorem Theorem 2.9 If (H2) and (H6) are satisfied, then the following results hold a If s and Λ p2 − 3q 0, then for any τ 0, all roots of 2.11 have negative real parts...
- 14
- 447
- 0
Báo cáo hóa học: "Research Article Global Behavior for a Diffusive Predator-Prey Model with Stage Structure and Nonlinear" docx
Ngày tải lên :
21/06/2014, 20:20
... Mathematical Analysis and Applications, vol 279, no 1, pp 1–21, 2003 21 M Wang, Nonliear Parabolic Equation of Parabolic Type, Science Press, Beijing, China, 1993 22 H Amann, “Dynamic theory of ... theory of quasilinear parabolic equations—II: reaction-diffusion systems,” Differential and Integral Equations, vol 3, no 1, pp 13–75, 1990 23 H Amann, “Dynamic theory of quasilinear parabolic systems—III: ... Transactions of the American Mathematical Society, vol 284, no 2, pp 729–743, 1984 E N Dancer, “On positive solutions of some pairs of differential equations II,” Journal of Differential Equations,...
- 19
- 303
- 0
OPTIMAL placement of FACTS devices by genetic algorithm for the increased load ability of a power system
Ngày tải lên :
26/03/2016, 02:38
... cycle and individuals of same population with improved characters are created in the next generation The objective function is then again calculated for all the individual of the new generation and ... with FACTS devices for are shown The magnitude and phase angle of the bus voltages with & without FACTS Devices for 200% of loading are shown in Table Phase angles are given in radian The locations ... capacity and location There are two distinct means of placing a FACTS device in the system for the purpose of increasing the system’s ability to transmit power, thereby allowing for the use of...
- 6
- 541
- 0
A STUDY ON THE RELIABILITY OF THE FINAL ACHIEVEMENT COMPUTER-BASED MCQS TEST 1 FOR THE 4TH SEMESTER NON - ENGLISH MAJORS AT HANOI UNIVERSITY OF BUSINESS AND TECHNOLOGY
Ngày tải lên :
10/04/2013, 14:46
... tests are more difficult than what they have learnt and studied for the exam, others say that these test items are easy and relevant to what they have been taught Therefore finding out whether the ... OF FOREIGN LANGUAGES DEPARTMENT OF POSTGRADUATE STUDIES CANDIDATE S STATEMENT I hereby state that I: Nguyen Thi Viet Ha, Class 1 4A, being a candidate for the degree of Master of Arts (TEFL) accept ... evaluate the quality of learning and teaching Also, test reliability is one of the most important criteria for the evaluation of a test Practically, the study presents how reliable the final achievement...
- 64
- 1.1K
- 1
A research proposal submitted in partial fulfillment of the requirements for the degree of Master of Business Administration
Ngày tải lên :
13/04/2013, 10:30
... Philippines; Macro is in Thailand and Taiwan, Carrefour from France is in Taiwan; and Wellcome is in Taiwan, Hong Kong, Mainland China and Singapore Major Japanese department stores are in most Asian cities ... it already has 27 supermarkets in China and has an ambitious expansion plans of a chain of 1000 supermarkets operating across the country by the year 2005 Meanwhile, WalMart with its openings of ... to cater for the top end of the market They are markets of the futures What took 20 years to achieve in Hong Kong and Singapore has been achieved in less than 10 years in Taiwan And what has been...
- 51
- 1K
- 3
Sanitation in Urban Poor Settlement and the Importance of Education for the Reduction of the Diffused Pollution - A Case Study of Bauniabad, Bangladesh
Ngày tải lên :
05/09/2013, 09:08
... and water quality analysis of the biogas plants were conducted BACKGROUND Study area Bangladesh lies in the northeastern part of South Asia, and has an area of 147,570 km2 It is one of the most ... populated countries of the world, with a population of about 129 million in 2001(Bangladesh Bureau of Statistics, 2002) Dhaka is the capital city of Bangladesh, and Bauniabad is one of the urban ... quality analysis of the biogas plant system, it was revealed that the anaerobic digestion of the biogas plants did not perform well as designed, and the water quality of the discharge from the...
- 9
- 971
- 0
Formation of Aerobic Granular Sludge in a Continuous-Flow Reactor – Control Strategy for the Selection of Well-Settling Granular Sludge
Ngày tải lên :
05/09/2013, 10:15
... Overhead view Fig - Schematic diagram of the AUFB reactor Reactor Setup and Operation for the Formation of Aerobic Granular Sludge Two AUFB reactors were used for the formation of aerobic granular ... (suspended biomass) to form aerobic granular sludge for all the experiments was obtained from an aerobic basin of a municipal wastewater treatment plant (Tokyo, Japan) Table - Wastewater composition ... (including a gas-solid separator), an internal diameter of cm, and a height of 3.2 m, were used for all experiments The schematic illustration of the AUFB reactor is shown in Fig Although the AUFB reactor...
- 8
- 481
- 0
Optimal placement of horizontal - and vertical - axis wind turbines in a wind farm for maximum power generation using a genetic algorithm
Ngày tải lên :
05/09/2013, 17:03
... modify the Jensen’s model [4] of the wake and apply it to determine the wake of a VAWT Now, the cross-section area of the streamtube is a square of width 2R and height H instead of a circle From the ... grid arrangement is also best in the case of a VAWT for optimal power generation Wake, power and cost modeling of a HAWT 2.1 Jensen's wake modeling of a HAWT All the results reported to date in the ... shows the convergence history of the GA optimization for VAWT wind farm The results are given in Table The optimal layout is the same as that of a HAWT as shown in Figure Table Optimization results...
- 12
- 635
- 1