performance comparison of geocast routing protocols for a manet

... baseband-to-baseband channels from A toBandfromBtoAare  h AB = he j(ϕ A −ϕ B ) ,  h BA = he j(ϕ B −ϕ A ) =  h AB e 2j(ϕ B −ϕ A ) . (4) They are reciprocal, that is,  h AB =  h BA if A and ... T. Cui, F. Gao, and A. Nallanathan, “Optimal training design for channel estimation in amplify and forward relay networks,” in Proceedings of the 50th Annual IEEE Global Telecommunications Conference ... orthogonal channels back to the relays. This results in a total of 2N R orthogonal channel uses if none of the relay nodes acts as a master node (If a relay acts as master, the number of orthogonal channelusesreducesto2(N R −...

Ngày tải lên: 21/06/2014, 17:20

... is based on Shannon’s entropy. It is a statistical measurement of the capability of a feature to separate digit classes. If the information measure of a feature is high, it indicates that the ... for the use of neural network learning techniques for this type of application and data set, and insight about the appropriate design, use, and parameterization of the network to achieve acceptable ... between a feature’s template and the input image. A value of 0 indicates that a feature template did not match the digit image; a value of 1 indicates a complete match; and values in between these...

Ngày tải lên: 28/04/2014, 10:10

... Protection Agency), ASTM (American Society for Testing and Materials), AFNOR (Association Franỗaise de Normalisation), and ISO (International Organization for Standardization). The test standard establishes ... pre-defined evaluation criteria . A major advantage of using a structured way of evaluating data is increased transparency and predictability of the risk assessment process. For instance, both a ch ecklist and ... 42(15):5807-5813. 6. Molander L, Ågerstrand M, Rudén C: WikiPharma a freely available, easily accessible, interactive and comprehensive database for environmental effect data for pharmaceuticals. Regulatory Toxicology...

Ngày tải lên: 21/06/2014, 03:20

Ngày tải lên: 22/06/2014, 19:20

Ngày tải lên: 22/06/2014, 22:20

Ngày tải lên: 23/06/2014, 00:20

Ngày tải lên: 08/08/2014, 14:21

Ngày tải lên: 14/08/2014, 20:20

Ngày tải lên: 05/09/2013, 08:40

... the Department of Electronics and Informatics, University of Padova, 35131 Padova, Italy. L. Malesani and P. Mattavelli are with the Department of Electrical Engineering, University of Padova, 35131 ... with analog PWM, although very simply implementable by means of analog circuitry, provides a rather unsatisfactory performance level as far as active filter applications are concerned. This is mainly due ... kind of application, to perform the – transformation, there is no need to know the instantaneous phase angle of the sinusoidal waveforms. The main advantage of such a solution is that the funda- mental...

Ngày tải lên: 03/01/2014, 19:45

... a system provides services for routine events. For example - a smart hospi- tal, responding to the arrival of critical patients may automatically allocate appropriate resources such as available ... current state, and 2. the average probabilities of success for reaching the normal state from each of the neighbor state. These average probabilities of success of reaching the normal state from any ... reaching if no additional criticality occurs at state , and is the av- erage probability of reaching if an additional criticality occurs at state . If the is not met for any state transition path in...

Ngày tải lên: 07/03/2014, 17:20

... H + -ATPase of Neurospora crassa Proposal for a proton pathway from the analysis of internal cavities Olivier Radresa 1 , Koji Ogata 2 , Shoshana Wodak 2 , Jean-Marie Ruysschaert 1 and Erik Goormaghtigh 1 1 Service ... characterized by the formation of a covalent enzyme-aspartyl phosphate intermediate [2,3,42,43]. The 3D structures of PMA1_NEUCR and of another P-type ATPase, the Ca 2+ -ATPaseofrabbitsarcoplasmic reticulum ... Neurospora crassa plasma-membrane H + -ATPase; ATC1_RABIT, Oryctolagus cuniculus (rabbit) Ca 2+ - ATPase of sarcoplasmic reticulum (splice isoform SERCA 1a) . (Received 27 May 2002, revised 23 A ugust...

Ngày tải lên: 23/03/2014, 21:20

... manage- ment may mislead stakeholders of the firm's corporate performance. This behavior can also explain the contractual behavior of senior management using accounting data (Healy and Wahlen, ... don't have to estimate the potentially noisy abnormal accruals (Healy and Wahlen, 1999). Another appealing feature is that the researchers can identify a large set of potential earnings manipulators ... Business Management, College of Management, National Taipei University of Technology, Taipei, Taiwan b Institute of Industrial and Business Management, College of Management, National Taipei University...

Ngày tải lên: 12/06/2014, 19:37

... clinical data from the charts on diagnosis and use of sedatives and hemodynamic treatments. The mismatch between human ability and the vast amount of data and information contributes to variation ... the same way, as soon as a valid SpO 2 is available. The ECP also will define how often the FiO 2 can be changed, the amplitude of change, and add additional rules: for example, define what ... virtual patients with realistic physiological and pathological behaviors for developing and validating ECPs before clinical trials. Several teams are already working on such platforms, although...

Ngày tải lên: 18/06/2014, 18:20

... NSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAA 53RGD motif- SGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQ 63RGD motif- SNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQPEVEK 73RGD motif- GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQ PEVEKPQKKP 83RGD ... GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAAAPAAQ PEVEKPQKKP 83RGD motif- TEQGGGGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGD TFATRAEEKRAEAEAAAEAA APAAQPEVEKPQKKPVIKPL Core Arg-Gly-Asp (RGD) ... CGGGATCCGCCGCGGCAATGCAGCC 43RGD -(as) CGGGATCCGGCAGCTTCGGCCGCTG 43RGD - (a) CGGGATCCAACTCCAACGCGGCAGCC 53RGD -(as) CGGGATCCTTGCGCAGCGGGGGC 53RGD - (a) CGGGATCCAGCGGCGCGGAAGAGAACTC 63RGD -(as) CGGGATCCCTTCTCGACCTCGGGTTGCG 63RGD...

Ngày tải lên: 20/06/2014, 01:20

... research center of Alexandria University. Author details 1 Department of Mathematics, Faculty of Education, Alexandria University, Alexandria, Egypt 2 Faculty of Industrial Education, Helwan University, ... AH Nasser 2 * Correspondence: zaki55@Alex-sci. edu.eg 1 Department of Mathematics, Faculty of Education, Alexandria University, Alexandria, Egypt Full list of author information is available at ... of 11 RESEARCH Open Access The equiconvergence of the eigenfunction expansion for a singular version of one- dimensional Schrodinger operator with explosive factor Zaki FA El-Raheem 1* and AH...

Ngày tải lên: 20/06/2014, 22:20

... Education, Alexandria University, Alexandria, Egypt Full list of author information is available at the end of the article Abstract This paper is devoted to prove the equiconvergence formula of the ... version of one- dimensional Schrodinger operator with explosive factor Zaki FA El-Raheem 1* and AH Nasser 2 * Correspondence: zaki55@Alex-sci. edu.eg 1 Department of Mathematics, Faculty of Education, ... Faculty of Education, Alexandria University, Alexandria, Egypt 2 Faculty of Industrial Education, Helwan University, Cairo, Egypt Authors’ contributions The two authors typed read and approved...

Ngày tải lên: 20/06/2014, 22:20

... Methods for a Countable Family of Strict Pseudo-contractions in Banach Spaces Rabian Wangkeeree and Uthai Kamraksa Department of Mathematics, Faculty of Science, Naresuan University, Phitsanulok ... either a p-uniformly convex Banach space which admits a weakly continuous duality mapping or a p-uniformly convex Banach space with uniformly G ˆ ateaux differentiable norm. As applications, at the ... Halpern, “Fixed points of nonexpanding maps,” Bulletin of the American Mathematical Society, vol. 73, pp. 957–961, 1967. 3 K. Aoyama, Y. Kimura, W. Takahashi, and M. Toyoda, “Approximation of...

Ngày tải lên: 21/06/2014, 11:20

... Theory and Its Application, Yokohama Publishers, Yokohama, Japan, 2000. 23 S. Reich, “Asymptotic behavior of contractions in Banach spaces,” Journal of Mathematical Analysis and Applications, vol. ... convergence theorems for resolvents of accretive operators in Banach spaces,” Journal of Mathematical Analysis and Applications, vol. 75, no. 1, pp. 287–292, 1980. 7 W. Takahashi and Y. Ueda, “On Reich’s ... Mathematical Analysis and Applications, vol. 241, no. 1, pp. 46–55, 2000. 15 H K. Xu, “Viscosity approximation methods for nonexpansive mappings,” Journal of Mathematical Analysis and Applications,...

Ngày tải lên: 21/06/2014, 20:20

... theorems of a modified hybrid algorithm for a family of quasi-φ-asymptotically nonexpansive mappings,” Journal of Computational and Applied Mathematics, in press. 25 Y. I. Alber, “Metric and generalized ... PanAmerican Mathematical Journal, vol. 4, no. 2, pp. 39–54, 1994. 27 I. Cioranescu, Geometry of Banach Spaces, Duality Mappings and Nonlinear Problems, vol. 62 of Mathematics and Its Applications, ... family of relatively nonexpansive mappings in a Banach space,” Journal of Mathematical Analysis and Applications, vol. 357, no. 2, pp. 356–363, 2009. 9 G. Lewicki and G. Marino, “On some algorithms...

Ngày tải lên: 21/06/2014, 20:20