na ca2 k exchanger structure function relationships

Tài liệu Báo cáo khoa học: Neuronal growth-inhibitory factor (metallothionein-3): structure–function relationships docx

Tài liệu Báo cáo khoa học: Neuronal growth-inhibitory factor (metallothionein-3): structure–function relationships docx

... conservative substitution linker RKS is found) (Fig 1) Hence, we constructed three mutants of hGIF in the link region (the K3 1 ⁄ 32A mutant, the K3 1 ⁄ 32E mutant and the KKS-SP mutant) and attempted ... linker in the structure and function of GIF [24] It was found that all three mutations reduce the stability of the b-domain and make it looser These results undoubtedly reflect that the linker KKS(31–33) ... find that nature produced such an elegant molecular device to perform a variety of biological functions.’ Acknowledgment The authors are grateful for financial support from the National Natural...

Ngày tải lên: 16/02/2014, 15:20

9 552 0
Báo cáo khoa học: New insights into structure–function relationships of oxalyl CoA decarboxylase fromEscherichia coli pptx

Báo cáo khoa học: New insights into structure–function relationships of oxalyl CoA decarboxylase fromEscherichia coli pptx

... Petoukhov MV, Konarev PV, Kikhney AG & Svergun DI (2007) ATSAS2.1 – towards automated and websupported small-angle scattering data analysis J Appl Crystallogr 40, 223–228 27 Konarev PV, Volkov ... catalytic function of two pyruvate decarboxylases Protein J 26, 585–591 15 Schutz A, Golbik R, Tittmann K, Svergun DI, Koch ¨ MHJ, Hubner G & Konig S (2003) Studies on ¨ ¨ structure function relationships ... chosen The final models were validated using procheck [35] All crystal structure figures were prepared using Pymol (http://www.pymol.org) Acknowledgements We gratefully acknowledge Dr Peter Konarev (EMBL...

Ngày tải lên: 06/03/2014, 11:20

13 436 0
Báo cáo khoa học: Evolutionary changes to transthyretin: structure–function relationships ppt

Báo cáo khoa học: Evolutionary changes to transthyretin: structure–function relationships ppt

... microheterogeneity of human thyroxinebinding prealbumin Biochem 26, 4572–4583 Sekijima Y, Tokuda T, Kametani F, Tanaka K, Maruyama K & Ikeda S (2001) Serum transthyretin monomer in patients with familial ... Maeda S, Shimada K, Nakashima H & Migita S (1985) Structure comparisons between mouse and human prealbumin J Biochem (Tokyo) 98, 1707– 1714 92 Wakasugi S, Maeda S & Shimada K (1986) Structure and ... Authors Journal compilation ª 2009 FEBS 5339 Structure function relationships of transthyretin P Prapunpoj and L Leelawatwattana 53 Southwell BR, Duan W, Alcorn D, Brack C, Richardson SJ, Kohrle J...

Ngày tải lên: 07/03/2014, 00:20

12 412 0
Báo cáo khoa học: Studies on structure–function relationships of indolepyruvate decarboxylase from Enterobacter cloacae, a key enzyme of the indole acetic acid pathway ppt

Báo cáo khoa học: Studies on structure–function relationships of indolepyruvate decarboxylase from Enterobacter cloacae, a key enzyme of the indole acetic acid pathway ppt

... specificities of these enzymes [45] Acknowledgements We thank J Koga (Meiji Seika Kaisha Ltd, Saitama, Japan) for providing the plasmid pIP362 and K. -P Rucknagel (Max-Planck¨ Society, Research Unit ÔEnzymology ... absorbance at 280 nm Ferritin (450 kDa), catalase (240 kDa), BSA (68 kDa), and ovalbumin (45 kDa) (Combithek, calibration proteins for chromatography, Ó FEBS 2003 Structure function studies of E cloacae ... benzoylformate analogues Biochemistry 27, 2197–2205 18 Krieger, F., Spinka, M., Golbik, R., Hubner, G & Konig, S ¨ ¨ (2002) Pyruvate decarboxylase from Kluyveromyces lactis An enzyme with an extraordinary...

Ngày tải lên: 08/03/2014, 02:20

10 430 0
Báo cáo khoa học: Protein tyrosine phosphatases: structure–function relationships ppt

Báo cáo khoa học: Protein tyrosine phosphatases: structure–function relationships ppt

... dimerization Nature 382, 555–559 Hoffmann KM, Tonks NK & Barford D (1997) The crystal structure of domain of receptor protein-tyrosine phosphatase mu J Biol Chem 272, 27505–27508 Nam HJ, Poy F, Krueger ... (MAM), Ig-like, fibronectin type III-like, carbonic anhydrase-like and cysteine-rich regions In addition, alternative splicing and post-translational modifications (mainly N- and O-linked glycosylation) ... USA) FEBS Journal 275 (2008) 867–882 ª 2008 The Authors Journal compilation ª 2008 FEBS 875 PTP structure function relationship L Tabernero et al the shift in the pKa and the altered kinetic behaviour...

Ngày tải lên: 30/03/2014, 04:20

16 319 0
Structure function relationships of variegin a novel class of thrombin inhibitors

Structure function relationships of variegin a novel class of thrombin inhibitors

... DDDDDDSGIPIFEMDDEDEDSNDNQKFP-LSFERFPENEKNQVGLRARFNKFMAKFTSLFGRRRG-VNVPNAA@ @@@@@@ @ @@@@@@ @ @ @ @ B Madanin YP-ERDSAKEGNQEQERALHVKVQKRTDG-DADYDEYEEDGTTPTPDPTAPTAKPRLRGNKP @ @ @ @ @ @ @ ... Madanin YP-ERDSAKDGNQEKERALLVKVQERYQGNQGDYDEYDQDETTPPPDPTAQTARPRLRQNQD @ @ @ @ @ @ @@ @ @@ @ @ Chimadanin QPKE KTKGVEVE GNPATLISARQMDVSYDEYEDNGPDVIPG -EPAKPRGGPKNGAASGKFDQIPDFSSESH @ ... magnetic resonance Par4 protease-activated receptor PCI percutaneous coronary intervention PDB Protein Data Bank PE pulmonary embolism PEG polyethylene glycol PK prekallikrein PL phospholipids pNA p-nitroaniline...

Ngày tải lên: 14/09/2015, 14:11

283 681 0
Tài liệu Báo cáo khoa học: Relationships between structure, function and stability for pyridoxal 5¢-phosphate-dependent starch phosphorylase from Corynebacterium callunaeas revealed by reversible cofactor dissociation studies doc

Tài liệu Báo cáo khoa học: Relationships between structure, function and stability for pyridoxal 5¢-phosphate-dependent starch phosphorylase from Corynebacterium callunaeas revealed by reversible cofactor dissociation studies doc

... (1995) Evolutionary link between glycogen phosphorylase and a DNA modifying enzyme EMBO J 14, 12871293 22 Lin, K. , Hwang, P .K & Fletterick, R.J (1997) Distinct phosphorylation signals converge ... Biochemistry 31, 41284133 Becker, S., Schnackerz, K. D & Schinzel, R (1994) A study of binary complexes of Escherichia coli maltodextrin phosphorylase: a-D-glucose 1-methylenephosphonate as a probe of pyridoxal ... Nidetzky, B (2003) Tracking interactions that stabilize the dimer structure of starch phosphorylase from Corynebacterium callunae Eur J Biochem 270, 21262136 16 Weinhausel, A., Griessler, R., Krebs,...

Ngày tải lên: 19/02/2014, 16:20

11 636 0
Nghiên cứu ảnh hưởng của tỉ lệ pha loãng, pH, áp suất thẩm thấu và các cation (Ca2+, K+, Na+) lên hoạt lực tinh trùng cá hồng bạc Lutjanus argentimaculatus (Forsskal, 1775)

Nghiên cứu ảnh hưởng của tỉ lệ pha loãng, pH, áp suất thẩm thấu và các cation (Ca2+, K+, Na+) lên hoạt lực tinh trùng cá hồng bạc Lutjanus argentimaculatus (Forsskal, 1775)

... 0,4 M Na+ ; 0,4 M K+ v 0,2 M Ca2+ ; trờn cỏ tm Ba T [25] l 0,25 M Na+ , 0,002 M K+ , 0,03M Ca2+ Vỡ vy, cỏc loi cỏ khỏc thỡ tinh trựng c k ch hot tt nht dung dch cú cỏc nng ion khỏc 33 CHNG 4: KT ... Ion Ca2+ ngoi bo c coi l mt iu kin tiờn quyt bt u ca s ng mt s loi cỏ Cỏc dũng Ca2+ bờn ngoi c thỳc y bi cỏc k ch thớch gõy k ch hot, v Ca2+ thõm nhp vo t bo cht ca tinh trựng tham gia vo s k ch ... hoc cỏc protein khỏc [34] Trong tinh trựng cỏ chộp, Krasznai v ctv [48] cho rng s xõm nhp ca canxi ngoi bo tng t nh s phỏt ca Ca2+ t cỏc kho d tr ni bo, nhng trng hp khụng cú dũng Ca2+ t bờn ngoi,...

Ngày tải lên: 20/03/2015, 09:00

56 728 1
Báo cáo y học: "Comparative study of serum Na+ and K+ levels in senile cataract patients and normal individuals"

Báo cáo y học: "Comparative study of serum Na+ and K+ levels in senile cataract patients and normal individuals"

... respectively Table shows serum Na+ , K+ of case and control groups, with a significant difference in serum + Na of case and control ones Table Comparison of Mean & SD of serum Na+ , K+ in 155 patients with ... Lens K+ level is 125 mmol/kg of lens water and lens Na+ is 14-26 mmol/kg of lens water [36] These two cations are in balance with each other, which is mainly due to Na+ -k+ ATP-ase pump and lens ... concentration, can be known as a risk factor for cataract formation Na+ pump activity in lens is as in other cells and it is related to intracellular Na+ , extracellular K+ and eventually to serum...

Ngày tải lên: 03/11/2012, 09:49

5 611 1
Tài liệu Báo cáo khoa học: Mixed lineage leukemia: a structure–function perspective of the MLL1 protein ppt

Tài liệu Báo cáo khoa học: Mixed lineage leukemia: a structure–function perspective of the MLL1 protein ppt

... MLL-associated leukemogenesis Cell 123, 207–218 Rozenblatt-Rosen O, Rozovskaia T, Burakov D, Sedkov Y, Tillib S, Blechman J, Nakamura T, Croce CM, Mazo A & Canaani E (1998) The C-terminal SET domains ... Schichman SA, Negrini M, Canaani E & Croce CM (1996) Complete exon structure of the ALL1 gene Cancer Res 56, 1766–1769 12 Nakamura T, Mori T, Tada S, Krajewski W, Rozovskaia T, Wassell R, Dubois ... lineage leukemia: role in gene expression, hormone signaling and mRNA processing FEBS J doi:10.1111/j.1742-4658.2010 07606.x 14 Yokoyama A, Kitabayashi I, Ayton PM, Cleary ML & Ohki M (2002) Leukemia...

Ngày tải lên: 16/02/2014, 14:20

11 762 0
Tài liệu Báo cáo khoa học: Structure-activity relationships of a-conotoxins targeting neuronal nicotinic acetylcholine receptors ppt

Tài liệu Báo cáo khoa học: Structure-activity relationships of a-conotoxins targeting neuronal nicotinic acetylcholine receptors ppt

... Med Chem 42, 415–426 37 Skjaerbaek, N., Nielsen, K. J., Lewis, R.J., Alewood, P & Craik, D.J (1997) Determination of the solution structures of conantokin-G and conantokin-T by CD and NMR spectroscopy ... Bertrand, D., Corringer, P.J., Changeux, J.P & Menez, A (1998) Functional determinants by which snake and cone snail toxins block the alpha neuronal nicotinic acetylcholine receptors J Physiol Paris 92, ... 589–595 36 Nielsen, K. J., Skjaerbaek, N., Dooley, M., Adams, D.A., Mortensen, M., Dodd, P.R., Craik, D.J., Alewood, P.F & Lewis, R.J (1999) Structure- activity studies of conantokins as human N-methyl-D-aspartate...

Ngày tải lên: 19/02/2014, 12:20

7 493 0
Báo cáo khoa học: Structure ⁄function analysis of spinalin, a spine protein of Hydra nematocysts doc

Báo cáo khoa học: Structure ⁄function analysis of spinalin, a spine protein of Hydra nematocysts doc

... Structurefunction analysis of spinalin S Hellstern et al ture ⁄ function analysis of full-length native spinalin A structure- based homology screen revealed ... FEBS Journal 273 (2006) 3230–3237 ª 2006 The Authors Journal compilation ª 2006 FEBS Structurefunction analysis of spinalin S Hellstern et al network of disulfide links In the case of spinalin, ... polyglycine type II helical Fig CD spectra of native and denatured spinalin Spectra were recorded at 25 °C Native spinalin in NaCl ⁄ Tris (d) and denatured spinalin in M guanidine hydrochloride (s)...

Ngày tải lên: 07/03/2014, 12:20

8 474 0
Báo cáo khoa học: Selectivity of pyruvate kinase for Na+ and K+ in water/dimethylsulfoxide mixtures docx

Báo cáo khoa học: Selectivity of pyruvate kinase for Na+ and K+ in water/dimethylsulfoxide mixtures docx

... comparison to Na+ and Mg2+, there is a higher selectivity between K+ and Mg2+ for their respective sites This is clearly evident in the ratios Ki Mg2+/KNa+, Ki Na+ /KMg2+ and Ki K+ /KMg2+ that are ... predominant factor in the control of the affinity for Na+ and K+ in pyruvate kinase Selectivity of pyruvate kinase for Na+ and K+ (Eur J Biochem 270) 2383 Ó FEBS 2003 Table Transfer energies for K+ ... dimethylsulfoxide, the Ki app for Na+ is approximately sixfold smaller than the Kapp for Na+ , making it difficult to obtain a good fit of the experimental points Na+ K+ Dimethylsulfoxide (%, w/v) kcat (s)1) Kappa...

Ngày tải lên: 08/03/2014, 02:20

9 461 0
RNA Structure Function

RNA Structure Function

... Thurs = Final Exam) 10/31/05 RNA Structure & Function Prediction Mon Review - promoter prediction RNA structure & function Wed RNA structure prediction 2' & 3' structure prediction miRNA & target ... http://bioinformatics.ubc.ca/resources/links_directory/?subcategory_id=104 http://www3.oup.co.uk/nar/database/subcat/1/4/ 10/31/05 New Today: RNA Structure & Function 10/31/05 RNA Structure & Function • RNA structure • Levels of organization • Bonds ... 10/31/05 MicroRNA Biogenesis N Kim Nature Rev Mol Cell Biol 2005 C Burge 2005 10/31/05 miRNA and RNAi pathways microRNA pathway RNAi pathway MicroRNA primary transcript Exogenous dsRNA, transposon,...

Ngày tải lên: 13/03/2014, 16:56

45 1,5K 0
RNA Structure Function bio( tiếp)

RNA Structure Function bio( tiếp)

... Thurs = Final Exam) 10/31/05 RNA Structure & Function Prediction Mon Review - promoter prediction Wed RNA structure prediction RNA structure & function 2' & 3' structure prediction miRNA & target ... http://bioinformatics.ubc.ca/resources/links_directory/?subcategory_id=104 http://www3.oup.co.uk/nar/database/subcat/1/4/ 10/31/05 New Today: RNA Structure & Function 10/31/05 RNA Structure & Function • RNA structure • Levels of organization • Bonds ... 10/31/05 MicroRNA Biogenesis N Kim Nature Rev Mol Cell Biol 2005 C Burge 2005 10/31/05 miRNA and RNAi pathways microRNA pathway RNAi pathway MicroRNA primary transcript Exogenous dsRNA, transposon,...

Ngày tải lên: 13/03/2014, 17:32

45 1,5K 0
Eukaryotic cell structure function biology lecture powerpoint VMC

Eukaryotic cell structure function biology lecture powerpoint VMC

...  Q: Eukaryotes? Prokaryotes? Both? From the Virtual Microbiology Classroom on ScienceProfOnline.com Image: Eukaryotic Cell Diagram, M Ruiz Cytoskeleton Nickname: Scaffolding & Highways Functions: ... Replication (duplication of DNA prior to cell division) occurs in all living things  Two locations of eukaryotic DNA – Nuclear DNA – Extranuclear DNA Image: Spectral karyotype, Jane Ades, NHGRI ... Might Be Giants • Prokaryotic & Eukaryotic: Two Types of Biological Cells, an article from SPO • Eukaryotic Cell: Structures, Functions & Diagrams article from SPO • Cell Structure tutorials and...

Ngày tải lên: 13/03/2014, 18:03

17 303 0
Eukaryotic cell structure function lecture

Eukaryotic cell structure function lecture

... of eukaryotic DNA – Nuclear DNA – Extranuclear DNA Image: Spectral karyotype, Jane Ades, NHGRI From the Virtual Cell Biology Classroom on ScienceProfOnline.co CYTOPLASM Nickname: The Matrix Function: ... reactions Q: Eukaryotes? Prokaryotes? Both? From the Virtual Cell Biology Classroom on ScienceProfOnline.com Image: Eukaryotic Cell Diagram, M Ruiz CYTOSKELETON Nickname: Scaffolding & Highways Functions: ... ScienceProfOnline.com Prokaryotes From the Virtual Cell Biology Classroom on ScienceProfOnline.com Eukaryotes Image: Phylogenetic Tree, Eric Gaba, NASA Astrobiology Institute Eukaryotic • Like prokaryotes,...

Ngày tải lên: 13/03/2014, 19:38

32 345 0
Báo cáo khoa học: Structure–function relationship of novel X4 HIV-1 entry inhibitors – L- and D-arginine peptide-aminoglycoside conjugates pptx

Báo cáo khoa học: Structure–function relationship of novel X4 HIV-1 entry inhibitors – L- and D-arginine peptide-aminoglycoside conjugates pptx

... Biophys Acta 1614, 51–61 Tachibana K, Hirota S, Iizasa H, Yoshida H, Kawabata K, Kataoka Y, Kitamura Y, Matsushima K, Yoshida N, Nishikawa S et al (1998) The chemokine receptor CXCR4 is essential ... gastrointestinal tract Nature 393, 591–594 Zou YR, Kottmann AH, Kuroda M, Taniuchi I & Littman DR (1998) Function of the chemokine receptor CXCR4 in haematopoiesis and in cerebellar development Nature ... protection of amino functions in aminoglycosides: a review of possible approaches Bull Soc Chim Belg 101, 709–717 Borkow G, Vijayabaskar V, Lara HH, Kalinkovich A & Lapidot A (2003) Structure activity...

Ngày tải lên: 16/03/2014, 06:20

14 434 0
Báo cáo khoa học: Structure–function analysis of the filamentous actin binding domain of the neuronal scaffolding protein spinophilin pot

Báo cáo khoa học: Structure–function analysis of the filamentous actin binding domain of the neuronal scaffolding protein spinophilin pot

... domain (ABD) by protein kinase-A (PKA) [28], calcium ⁄ calmodulindependent kinase II [29], cyclin-dependent kinase-5 and extracellular signal-regulated kinase-2 (ERK2) [30] PKA phosphorylates three ... a synaptic protein linking p70 S6 kinase and the 17 18 19 20 21 22 23 24 25 26 FEBS Journal 275 (2008) 59–68 ª 2007 The Authors Journal compilation ª 2007 FEBS neuronal cytoskeleton Proc Natl ... Rho kinase: evidence for two forms of spine motility Mol Cell Neurosci 26, 429–440 12 Nakanishi H, Obaishi H, Satoh A, Wada M, Mandai K, Satoh K, Nishioka H, Matsuura Y, Mizoguchi A & Takai Y...

Ngày tải lên: 16/03/2014, 06:20

10 438 0
Báo cáo khoa học: Effect of valine 106 on structure–function relation of cytosolic human thymidine kinase Kinetic properties and oligomerization pattern of nine substitution mutants of V106 ppt

Báo cáo khoa học: Effect of valine 106 on structure–function relation of cytosolic human thymidine kinase Kinetic properties and oligomerization pattern of nine substitution mutants of V106 ppt

... between dNK and dGK [29], and 47% between dGK and dCK [28], and the structures of dNK, dGK and dCK appeared to be very similar [27,28] Despite the very low sequence identity of the cellular kinases ... the multisubstrate deoxynucleoside kinase from Drosophila melanogaster, dNK, the human deoxyguanosine kinase, dGK [27], and the human deoxycytidine kinase, dCK [28] Despite the very low overall ... thymidine kinase (HSV1TK) [22–26] In 2001, the X-ray crystallographic structure was reported for two cellular deoxynucleoside kinases – the Drosophila melanogaster multisubstrate deoxynucleoside kinase...

Ngày tải lên: 16/03/2014, 16:20

9 447 0
w