k g 1 spaces and graphs of groups
Đề tài " Grothendieck’s problems concerning profinite completions and representations of groups " pot
Ngày tải lên :
28/03/2014, 22:20
... representations of groups, K- Theory (19 90), 89 10 1 [13 ] L Pyber, Groups of intermediate subgroup growth and a problem of Grothendieck, Duke Math J 12 1 (2004), 16 9 18 8 [14 ] E Rips, Subgroups of small ... product G1 ∗Fn G2 Similarly, if v1 ,1 , , v1,n generate a free subgroup of rank n in G1 , then 1 1 A1 , t | R1 , t 1 u1 ,1 tv1 ,1 , , t 1 u1,n tv1,n is an aspherical presentation of the corresponding ... 3-skeleton In Section 3 .1 of [6] Grothendieck considers the category C of those groups K which have the property that, given any homomorphism u : G1 → G2 of ˆ finitely presented groups, if u : G1 ...
- 16
- 332
- 0
1 principles and elements of power electronics
Ngày tải lên :
06/06/2014, 21:21
... rating 24.2.5 Service lifetime and reliability 11 11 Example 24.4: A1203 capacitor service life 25 .1 25.2 11 15 11 17 11 18 Plastic film dielectric capacitors 25.3 11 19 11 46 Resistor construction 11 46 ... operation 13 51 Glossary of terms 13 52 Glossary of Wafer Processing terminology Glossary of Fuselink terminology (Fuseology) Glossary of Relay terminology Glossary of Varistor terminology Glossary of ... Example 27 .1: Magnet load dependant operating point 27.6.3 Demagnetizing field xxviii 28 .10 13 14 Contact ratings 13 17 28 .12 High voltage relay grounding 13 18 28 .13 A LV voltage, 750V dc, high-current,...
- 731
- 1.2K
- 0
Báo cáo hóa học: "Research Article Quasicone Metric Spaces and Generalizations of Caristi Kirk’s Theorem" ppt
Ngày tải lên :
21/06/2014, 20:20
... y Acknowledgment This work is partially supported by the Scientific and Technical Research Council of Turkey References L. -G Huang and X Zhang, “Cone metric spaces and fixed point theorems of contractive ... Sciences, vol 275, pp e e A1057–A1059, 19 72 12 K Deimling, Nonlinear Functional Analysis, Springer, Berlin, Germany, 19 85 ´ c 13 L B Ciri´ , “On a common fixed point theorem of a Greguˇ type,” Publications ... proof of i and ii were given in and the last one just follows from definition f ∞ f ∞ , and consider the Example 1. 2 see Let E C1 0, with the norm f cone P {f ∈ E : f ≥ 0} and g 2k For each k...
- 9
- 233
- 0
Báo cáo hóa học: " Research Article The Methods of Hilbert Spaces and Structure of the Fixed-Point Set of Lipschitzian Mapping" docx
Ngày tải lên :
21/06/2014, 20:20
... k x0 − T k x1 T k x0 − T k x1 Tk T k x1 − z1 · x0 − x1 Tk Tk 2 Tk 2 T k x0 − T k x1 · T k x1 − z1 T k x1 − z1 T k · x0 − x1 · T k x1 − z1 · x0 − x1 · diam C · diam C · x0 − x1 T k x1 − z1 T k ... z1 2 .16 2 .17 k ε Similarly, ∞ n→∞ an ,k · T k x1 − z0 R1 < lim sup k · diam C · x1 − x0 · lim sup n→∞ · B · diam C · η R0 ∞ an ,k · T k lim sup n→∞ k ∞ an ,k · T k x0 − z0 k ε From 2 .16 and 2 .17 ... N Ts · Proof Fix s ∈ N, then we have ∞ an ,k T s z − T k u k s an ,k T s z − T k u k s an ,k T s z − T k u k ∞ an ,k z − T k s u 3.4 k s Ts · ∞ an ,k z − T k s u k − s an ,k z − T k s u k Fixed Point...
- 12
- 393
- 0
Báo cáo y học: "Silencing CD36 gene expression results in the inhibition of latent-TGF-β1 activation and suppression of silica-induced lung fibrosis in the rat" pdf
Ngày tải lên :
12/08/2014, 14:20
... http://respiratory-research.com/content /10 /1/ 36 Quantity of TGF- 1 and the percentage of active TGF- 1 in BALF Figure Quantity of TGF- 1 and the percentage of active TGF- 1 in BALF (A–a) The quantity of total and active TGF- 1 in ... activity of TGF-β and prevents bleomycin mediated lung fibrosis J Clin Invest 2004, 11 4 :13 08 -13 16 Khalil N, Whitman C, Zuo L, Danielpour D, Greenberg A: Regulation of alveolar macrophage transforming ... activation of L-TGF- 1 was determined by detecting the quantity of TGF- 1 in BALF using the CCL-64 growth inhibition assay The quantities of total TGF- 1 and active TGF- 1 from BALF in silica group, silica+Lv-shCD36...
- 9
- 365
- 0
Báo cáo y học: " Decorin and TGF-β1 polymorphisms and development of COPD in a general population" ppt
Ngày tải lên :
12/08/2014, 16:20
... (5) 0.0 01 Decorin rs 313 82 41 GG GA AA 863 (88) 11 4 (12 ) (0) 13 6 (89) 10 (11 ) (1) 0.733 Decorin rs 111 06030 CC CA AA 996 (87) 14 2 (12 ) (1) 17 0 ( 91) (8) (1) 0. 217 Decorin rs1803343 AA AG GG 10 79 (94) ... 0.797 AA AG GG 10 39 19 8 20 -18 .6 -20 .1 -14 .1 -1. 5 +4.5 0.287 0.346 13 1 43 -35 .1 -38.2 -23.2 -3 .1 +11 .9 0.439 0.282 AA AG GG 737 519 96 -18 .8 -18 .5 -18 .9 +0.3 +0 .1 0. 814 0.969 10 2 65 15 -34.4 -35.9 ... +8.3 0.297 0.239 GG GA AA 716 555 10 3 -18 .9 -17 .6 -20.3 +1. 2 -1. 5 0.5 01 0.437 10 6 67 10 -34.3 -36.2 - 31. 9 -1. 9 +2.4 0.587 0.698 GG GA AA 477 623 18 5 -19 .1 -17 .9 -17 .9 +1. 2 +1. 2 0.309 0.593 75...
- 8
- 384
- 0
Part 1 development and application of hantzsch ester and hypervalent iodine reagent
Ngày tải lên :
11/09/2015, 10:15
... cleavage process 10 Figure 1- 8 Safety-catch Linkers 12 Figure 2 -1 Library of 2 -1- 16, 2 -1- 17, 2 -1- 18, 2 -1- 19, 2 -1- 20 31 Figure 3 -1 Polymer-supported Hantzsch ester 56 Figure 3-2 Reduction of Ketimines ... irradiated at 14 0 oC for 40 Figure 2 -1 Library of 2 -1- 16, 2 -1- 17, 2 -1- 18, 2 -1- 19, 2 -1- 20 32 2.2.2.3 Solid-Phase Synthesis of 2 -1- 16, 2 -1- 18, 2 -1- 19 and 2 -1- 20 To illustrate the versatility of this ... Backes, B J.; Ellman, J A J Am Chem Soc 19 94, 11 6, 11 1 71- 111 72 (b) Backes, B J.; Virgilio, A A.; Ellman, J A J Am Chem Soc 19 96, 11 8, 3055-3056 (c) Golisade, A.; Herforth, C.; Wieking, K. ; Kunick,...
- 134
- 293
- 0
UNIT 1 structure and properties of matter
Ngày tải lên :
01/12/2015, 22:44
... Properties of Metals Melting and Boiling Points • the stronger the bonding forces, the higher the melting and boiling points of pure metals Periodic table trends include: For Group 1, melting points ... Bonding and Properties of Matter 4 .1 Models of Chemical Bonding Three types of chemical bonding are ionic, covalent, and metallic TO PREVIOUS SLIDE Section 4 .1 UNIT Chapter 4: Chemical Bonding and ... Chapter 3: Atomic Models and Properties of Atoms Learning Check HCN has two bonding groups and no lone pairs The electron-group arrangement is linear, and the shape of the molecule is also linear...
- 58
- 495
- 0
Báo cáo y học: "HLA-G DNA sequence variants and risk of perinatal HIV-1 transmission" pptx
Ngày tải lên :
10/08/2014, 05:20
... of HLA-6.0 by Geraghty et al [16 ] Primers for 5'URR, (5hlag1F: 5'-GGGTTTCTC CCTGGTTTCTC-3' (forward) and 3hlagex1R 5-CGAGGAGGGGTTGAGACC -3' (reverse)), generated a 550-bp fragment as a part of ... 634 C /G 714 ins T ,G 10 74 A/T 11 54 G/ A 14 86 C /G 14 86 C/A 14 88 C/T 15 28 G/ A 15 37 C/A 15 97 del C 2575 G/ A 2577 T/A 2 614 C/A 2622 C/A 34 01 ins C 3579 G/ A 3585 G/ T 3 619 C /G 3742 T/A 3743 C/T 3777 G/ C ... [7,8 ,14 ,18 ,19 ] Fourteen out of 21 (67%) variants, (G6 34C, 714 insT, C148 6G, C1486A, G2 575A, T2577A, C2 614 A, C2622A, 3401insC, G3 579A, G3 585T, C3 61 9G, T3742A, and C3743T) (Table 1; Figures and 2),...
- 8
- 358
- 0
Homotopy theory of suspended lie groups and decomposition of loop spaces
Ngày tải lên :
09/09/2015, 18:49
... |vi | Let bk = s πj (Σ n i =1 n k i =1 ((2 − 1) (|ui | + |vi |)), and Σ Xi ) is a summand of πj+bk (Σ n i =1 n i =1 Xi is (m − 1) -connected Then Xi ) for large enough k such that j ≤ bk + 2m In particular, ... 4n (2) ΩP ( 8k+ 4)n− 3k (2)×? Thus π (1 6k+ 8)n− 6k 2 (P 4n (2)) contains a Z/8Z-summand, for all k ∈ Z≥0 such that k ≡ 2(mod 4) ΩP 4n +1 (2) ΩP ( 8k+ 4)n +1 k (2)×? Thus π (1 6k+ 8)n− 2k (P 4n +1 (2)) contains ... thesis has two parts Investigating the homotopy of ΣSO(n) and showing that it has nonzero homotopy groups Investigating the homotopy of ΩΣX for some special spaces X and giving some product decomposition...
- 70
- 283
- 0
Analysis of regulator of g protein signaling (RGS) function in growth, development and pathogenicity of magnaporthe grisea 1
Ngày tải lên :
14/09/2015, 09:13
... mutants (magAG187S, magBG183S, and magCG184S) revealed that Rgs1 directly regulates MagA during appressorium initiation Interestingly, rgs1∆ and magAG187S accumulated higher levels of cAMP compared ... et al 19 98) A canonical MAPK pathway is composed of MAP kinase, MAP kinase kinase (MAPKK) and MAP kinase kinase kinase (MAPKKK) G- protein mediated mating signaling activates Ste 11, a MAPKKK in ... in Magnaporthe……… 11 0 Figure 35 Rgs1 acts coordinately with MagB to regulate of mycelial hydrophobicity 11 1 Figure 36 Hydrophobin gene expression in wild-type and rgs1∆ 11 3 Figure 37 Rgs1 interacts...
- 220
- 228
- 0
Tài liệu Manual on the Production and Use of Live Food for Aquaculture - Phần 1 pptx
Ngày tải lên :
15/12/2013, 00:15
... 5 .1. 3 Collection techniques 5 .1. 3 .1 Plankton nets 5 .1. 3.2 Trawl nets 5 .1. 3.3 Baleen harvesting system 5 .1. 3.4 Flow-through harvesting 5 .1. 3.5 Plankton light trapping 5 .1. 4 Zooplankton grading ... 4 .1. 1 Introduction 4 .1. 2 Biology and ecology of Artemia 4 .1. 2 .1 Morphology and life cycle 4 .1. 2.2 Ecology and natural distribution 4 .1. 2.3 Taxonomy 4 .1. 2.4 Strain-specific characteristics 4 .1. 3 ... classes and genera of cultured algal species 2.3 Algal production 2.3 .1 Physical and chemical conditions 2.3 .1. 1 Culture medium/nutrients 2.3 .1. 2 Light 2.3 .1. 3 pH 2.3 .1. 4 Aeration/mixing 2.3 .1. 5...
- 15
- 790
- 2
Chapter 1 - The role and environment of managerial finance
Ngày tải lên :
16/12/2013, 14:45
... 97 814 42 518 193/ Gitman et al / Principles of Managerial Finance / 6th edition Finance and Business Strengths of the basic legal forms of business organisation Table 1. 1, page Copyright © 2 011 ... Institutions and Markets Supply and demand for a security Page 27 Copyright © 2 011 Pearson Australia (a division of Pearson Australia Group Pty Ltd) – 97 814 42 518 193/ Gitman et al / Principles of Managerial ... Primary activities of the financial manager Page 12 Copyright © 2 011 Pearson Australia (a division of Pearson Australia Group Pty Ltd) – 97 814 42 518 193/ Gitman et al / Principles of Managerial Finance...
- 30
- 540
- 1
Tài liệu Lab 3.1.1 Safe Handling and Use of a Multimeter docx
Ngày tải lên :
21/12/2013, 19:15
... check high voltages, extra care should be taken to avoid electrical shock Step Insert the red and black leads into the proper jacks on the meter a The black probe should go in the COM jack and ... other end of a battery a Is any number showing up on the multimeter? _If not, make sure to switch to the correct type of measurement For example Vol, voltage, or V If the voltage is negative, ... multimeter to the voltage measurement a What is the symbol for this? _ Step Put the tip of the red, positive lead on the positive side of a battery Put the tip of the black, negative, lead on...
- 2
- 392
- 0
Tài liệu Lab 3.1.1 Safe Handling and Use of a Multimeter doc
Ngày tải lên :
18/01/2014, 04:20
... check high voltages, extra care should be taken to avoid electrical shock Step Insert the red and black leads into the proper jacks on the meter a The black probe should go in the COM jack and ... other end of a battery a Is any number showing up on the multimeter? _If not, make sure to switch to the correct type of measurement For example Vol, voltage, or V If the voltage is negative, ... multimeter to the voltage measurement a What is the symbol for this? _ Step Put the tip of the red, positive lead on the positive side of a battery Put the tip of the black, negative, lead on...
- 2
- 374
- 0
(1) how learners approach learning, both in and out of classrooms, and (2) the kinds of strategies and cognitive processing they use in second language acquisition
Ngày tải lên :
29/01/2014, 00:23
... affecting language learning strategies II.3 Overview of gender differences in L2 learning strategies Regarding the general use of language learning strategies, Green and Oxford (19 95) reveal that 15 ... Oxford, 19 89; Green & Oxford, 19 95; 32 Kaylani, 19 96; Noguchi, 19 91; Nyikos, 19 90; Oxford, 19 93; Oxford & Ehrman, 19 93; Oxford & Nyikos, 19 89; Politzer, 19 83; Sy, 19 94 & 19 95; Willing, 19 88; Yang, 19 92& ... and a wider range of strategies than those majoring in science/engineering in several studies (e .g. , Lee, 19 94; Park, 19 99) Dreyer and Oxford (19 96) and Oxford and Nyikos (19 89) also show significant...
- 83
- 622
- 0
Tài liệu Đề tài " Hypersurface complements, Milnor fibers and higher homotopy groups of arrangments " ppt
Ngày tải lên :
14/02/2014, 16:20
... descending central series { k }k 1 , and associated graded Lie algebra gr∗ π := k 1 ( k / k+ 1 ) One has Γ a map, k : k → I k , defined by k (x) = x − 1, for each k ≥ The maps { k } induce a graded ... 47–54 A Dimca and G I Lehrer, Purity and equivariant weight polynomials, in Algebraic Groups and Lie Groups (G I Lehrer, ed.), Cambridge Univ Press, Cambridge (19 97), 16 1 18 1 ˘ A Dimca and L Paunescu, ... Higher homotopy groups of complements of complex hyperplane arrangements, Adv Math 16 5 (2002), 71 10 0 D Quillen, On the associated graded ring of a group ring, J Algebra 10 (19 68), 411 – 418 , Rational...
- 36
- 323
- 0
Tài liệu Báo cáo khoa học: Identification of Ewing’s sarcoma protein as a G-quadruplex DNA- and RNA-binding protein ppt
Ngày tải lên :
15/02/2014, 01:20
... SAGERGGFNKPGGPMDEGPDLDLGPPVDP APKPEGFLPPPFPPPGGDRGRGGPGGMRGGRGGLMDRGGP GGMFRGGRGGDRGGFRGGRGMDRGGFGGGRRGGPGGPP GPLMEQMGGRRGGRGGPGKMDKGEHRQERRDRPY Figures S1 and S2 show that RGG3 binding to Htelo ... AGGG(TTAGGG) ]⁄ d[CCCTAA) CCCT] ( 3 d[ AGGG(TTAGTG) TTAGGGJ r (UUAGGG) r[ UUAGGG(UUAGUG) UUAGGG] Table Amino acid sequences of RGG1 and RGG3 RGG1 RGG3 PGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMG SAGERGGFNKPGGPMDEGPDLDLGPPVDP ... RGG F MF KGG KGG D RGG F RGG RGMD RGG F MF KGG KGG D KGG F KGG RGMD RGG F MF KGG KGG D KGG F KGG KGMD KGG F Fig Identification of significant residues at RGG3 for G- quadruplex binding ability (A)...
- 11
- 786
- 0
Tài liệu Tolley’s Basic Science and Practice of Gas Service Gas Service Technology Volume 1 docx
Ngày tải lên :
16/02/2014, 07:20
... operatives wishing to improve their knowledge and understanding of natural gas and Liquefied Petroleum Gas (LPG) systems I would like to thank manufacturers for the use of photographs and diagrams, in ... propane and butane, are unlikely to have lighting-back problems FIGURE 2 .12 Flame structure with high primary aeration FIGURE 2 .13 Lighting-back FLAME LIFT This is the opposite of lighting-back If ... Total 10 0 2:5 Â ¼ 12 :5 16 :5 Â 13 ¼ 10 7:25 10 2.74 So m3 of butane requires 1. 0274 m3 of oxygen – near enough m3 Butane/air 1: 027 Â 10 0 ¼ 4:89 m3 of air or roughly m3 21 PRODUCTS OF COMBUSTION It...
- 481
- 2K
- 0