is it possible two model approach to a generic gui

... the model seems to include a decision phase only as an approach to laboratory settings, where participants are usually asked to state their preferences or make decisions about a certain aspect ... A Biological Approach to a Model of Aesthetic Experience 430 431 Chapter Twenty One flow has certain temporal characteristics associated with it This feature allows one to test the temporal ... MEG and fMRI has to with temporal and spatial resolution Whereas MEG has a low spatial resolution compared with fMRI, its temporal resolution is significantly greater In addition to locating brain...

Ngày tải lên: 19/02/2014, 17:20

... 15 and may take as long as three weeks Manual picking is disappearing, since it costs more and may take too much time Automatic picking is faster, allowing thus to harvest at the right maturity, ... into vats and fermentation can start Several chemical decisions have to be made at this point These consist in: adding sulfite (which has many complex effects and is practised by all châteaux); ... several years for every vintage, though nowadays it is said that a good chemist can make miracles Wine is also the subject of many legends and production secrets Wine tasting adds to this aura of...

Ngày tải lên: 22/02/2014, 09:20

... order to represent the characteristics of disfluencies in spontaneous speech as well as model the adjacent output labels The additional features we introduced are: • the distance to the next same ... one, together with some observation features such as the unigram and bigrams of word or POS tag 3.2 Discriminative Reranking Although CRFs is able to model the dependency of adjacent labels, it ... the performance gain for this condition is that there is less data imbalance in model training (since we split the n-best list, each containing fewer negative examples) We also notice that the compression...

Ngày tải lên: 07/03/2014, 18:20

... ways and the whole retrieval process should adopt a two- stage architecture A research area that is closely related to IR is question answering (QA), the differences being a) the input of a QA ... system is a question rather than a few key words; b) a QA system aims to extract answers to a question rather than retrieving relevant documents only Most QA systems adopt a two- stage architecture ... Adapted Naive Bayes, refers to Naive Bayes, refers to ME, refers to ADTree and refers to Linear Regression Ranking Method Agreement with Subject Agreement with Subject Average Adapted Naive Bayes...

Ngày tải lên: 24/03/2014, 03:20

... each aource grammar There is no convenient way to sta~e more global linguistic facts t h a t don't relate to immediate constituent structure (this is a problem for analysis as well) ALso, this ... grammar and under control of the grammar writer, the overall t r a n ~ e r efficiency is not degraded by the use of a transfer grammar Any additional cost associated with the use of this grammar ... lexical and structural transfer of both, as well as the structural transfer of the clause as a whole, it is very useful to a certain amount of lexical transfer, in particular, verb transfer, at...

Ngày tải lên: 01/04/2014, 00:20

... hour traffic is simulated by adding a number of active users within the network area Through statistical analysis of actual traffic data, a traffic density map of the area is generated, and then ... percentage of active users within the network area that can achieve a pre-defined minimum data rate For the network to be considered as having a satisfactory performance, at least a 95% user satisfaction ... supported within the same unit Alternatively, if additional spectrum is not available, existing sites can be upgraded through sectorization, typically going from a to sector site From a capacity point...

Ngày tải lên: 21/06/2014, 17:20

... http://www.flickr.com/photos/justageek/2300396608/ IT S THE PROCESS When I Started Design the Idea Refine the Idea Today Sell the Idea Future Conceptualize the Idea 33,505 visits 17,097 visits 13,675 visits 4,821 ... / visit 46 send / visit 43 send / visit http://www.flickr.com/photos/cjrphotos/3731282404/ WHAT problem is this solving? WHY is the user here? HOW can I make it better? HIGHER LEVELS ARE ... http://www.flickr.com/photos/cjrphotos/3731282404/ http://www.flickr.com/photos/jm3/3711253360/ http://www.flickr.com/photos/lilit/3551805611/in/set-72157617184141890 “ WE ARE NO LONGER EVANGELISING UX INSTEAD WE ARE...

Ngày tải lên: 21/07/2014, 11:50

... animal populations when a single QTL is marked Genet Res Camb 66, 71-83 Saito S, Iwaisaki H (1996) A reduced animal model with elimination of quantitative trait loci equations for marker assisted ... computed as and A are appropriate submatrices of A A and A respec, au , v p v is the vector corresponding to animali of T, q is the matrix corresponding i to animali of B, is the vector ( )! and stands ... variance-covariance structure for the total additive genetic given by where A is the combined numerator relationship matrix, and a 2(= o! + 2a! ) is a the variance component of the total additive...

Ngày tải lên: 09/08/2014, 18:22

... Netherlands Mauritius Italy Canada Korea Sweden Denmark Austria Macao Belgium Spain Cyprus Switzerland Kazakhstan Malaysia Australia Thailand Finland Egypt Bahrain Indonesia Philippines Isle of Man Portugal ... this thesis also aims to provide an explanation to Asean+3 refers to Asean, Japan, Korea and China Unfortunately, China is a not a participant of the CPIS survey, the main data source that is used ... financial variables, such as stock market capitalization, have a higher explanatory power than macroeconomic variables such as output and international trade Dasgupta and Ratha (2000) found that...

Ngày tải lên: 04/10/2015, 07:39

... bolted to the testing table for stability To enforce an anatomic boundary condition at the pubis, the pubic symphysis rested on a block of wood that was cut at an angle that matched the anatomical ... construct The customized jig was oriented to allow femoral head load- Figure (A) The testing apparatus consists of a bipolar hemiarthroplasty attached to a servohydraulic materials testing machine (858 ... stability to two column fixation Materials and methods Forty urethane foam hemi-pelvises (Pacific Research Laboratories, Vashon, Washington), each with a well defined cortical outer shell and cancellous...

Ngày tải lên: 20/06/2014, 04:20

... GmNPR1-2 AtNPR1 MSSHTMADDLHMKLLYLENRVAFARLFFPSEAKLAMDIAHAETTSEFAGLSASNSKGSNG 474 MSSHTMADDLHMKLLYLENRVAFARLFFPSEAKLAMDIAHAETTSEFAGLSASNSKGSNG 474 PSFAVAADELKMTLLDLENRVALAQRLFPTEAQAAMEIAEMKGTCEFIVTSLEPDRLTGT ... moderate level of resistance against gray leaf spot and bacterial spot diseases [23] Similarly, wheat plants transformed with Arabidopsis NPR1 resulted in enhanced resistance against Fusarium graminearum ... high identity to Arabidopsis NPR1 was used to develop a primer pair (forward primer: 5'-GAG CCT TCC ATT ATA GTA TCC CTA CTT AC-3'; reverse primer: 5'-GAC CAG CAA ACT CAG ATG TTG TCT CAG CAT G-3')...

Ngày tải lên: 12/08/2014, 03:21

... specifically examine clinical and laboratory measures of disease activity to estimate remission rates in PsA patients and examine associated predictive factors Materials and methods We established a ... diagnostic criteria for according to American College of Rheumatology criteria [13], and PsA patients satisfied validated CASPAR criteria [16] All patients had clinically active disease, with DAS28 > 3.2 ... rheumatoid arthritis: analyses of disease activity, disease characteristics, and treatments in the QUEST-RA study Arthritis Res Ther 2009, 11:R7 James WH: Sex ratios and hormones in HLA related...

Ngày tải lên: 12/08/2014, 14:21

Ngày tải lên: 12/08/2014, 22:21

... Ejtehadi HD, Freimanis GL, Ali HA, Bowman S, Alavi A, Axford J, Callaghan R, Nelson PN: The potential role of human endogenous retrovirus K10 in the pathogenesis of rheumatoid arthritis: a preliminary ... transcriptase Nature 2008, 453(7192):184-9 Prats AC, Sarih L, Gabus C, Litvak S, Keith G, Darlix JL: Small finger protein of avian and murine retroviruses has nucleic acid annealing activity and ... functional RT-NC-RNA interactions in most, if not all, retroviruses, notably alpha- and gammaretroviruses such as ASLV and MLV's that contain a mature NC protein For Foamy viruses, the situation appears...

Ngày tải lên: 12/08/2014, 23:20

... Sensitivity analysis: Which are the most critical factors and how sensitive is the outcome to variances (actual vs estimated)? • Risk analysis: What is the possibility of a material underestimation ... process of financial analysis specifically for the project at hand That said, this Guide offers below a detailed outline for your financial analysis and planning The financial plan is a vital component ... both quantitative and qualitative terms Summarize outlook and reasons for enthusiasm and optimism, balanced against material risks PAGE MODEL BUSINESS PLAN: A SUPPLEMENTAL GUIDE FOR OPEN ACCESS...

Ngày tải lên: 23/03/2014, 02:20

... Peter Weis • UNAIDS: Karusa Kiragu • GNP+: Christoforos Mallouris • Young Positives: Raoul Fransen – dos Santos Reviewers included: Terhi Aaltonen, Sam Anyimadu-Amaning, Narimah Awin, Esi Awotwi, ... Hedia Belhadj, Gladys Brew, Leopoldina Cairo, Alicia Carbonell, Rebecca Carl-Spencer, Raquel Child, Catherine d’Arcangues, Alexandrine Dazogbo, Esperanza Delgado, Anna de Guzman, Galanne Deressa, ... Sergio Maulen, Rafael Mazin, Asha Mohamud, Alexis Ntabona, Rejoice Nutakor, Nuriye Ortayli, Cheick Ouedraogo, Rose Owusu Kakrah, Jewel Quallo-Rosberg, Gloria Quansah Asare, Patricia Quarshe-Yakuev,...

Ngày tải lên: 14/03/2014, 15:20

... the OD practitioner may also arrive after a project is already underway In this case, the OD practitioner may encourage the IT project manager to collaborate in creating a charter that describes ... required to deliver the IT project on time, within budget, and according to requirements It would be a mistake to assert that this approach is a panacea for the universe of pitfalls that can happen ... computers or software), database management and revision (ensuring proper data storage and access), hardware and software upgrades (replacing or enhancing existing assets), and network infrastructure...

Ngày tải lên: 24/10/2013, 08:20

Ngày tải lên: 18/02/2014, 11:20

... learns the acoustic characteristics of a language automatically and is able to produce an acoustic model that outperforms a language-mismatched acoustic model trained with high supervision Table shows ... corpus Andrew Gelman, John B Carlin, Hal S Stern, and Donald B Rubin 2004 Bayesian Data Analysis Texts in Statistical Science Chapman & Hall/CRC, second edition James Glass 2003 A probabilistic framework ... recognition by statistical methods Proceedings of the IEEE, 64:532 – 556 Sawit Kasuriya, Virach Sornlertlamvanich, Patcharika Cotsomrong, Supphanat Kanokphara, and Nattanun Thatphithakkul 2003 Thai...

Ngày tải lên: 07/03/2014, 18:20

... data models This approach yields a concise model that at the same time facilitates broader coverage than existing models, and is more easily scalable and maintainable We also introduce a cleaner ... such that the reader’s ability to access and compare information can be enhanced, as also noted by Wang (1996) From a database manage- • Flat model: A table is interpreted as a database table in ... 1dimensional cases A dimensional model is an inappropriate interpretation for non-cross-tabular tables, such as Table and Table A dimensional model is also not valid for tables such as Table Semantically,...

Ngày tải lên: 08/03/2014, 02:21