invoking a function in a conditional expression
Báo cáo y học: " High blood pressure, antihypertensive medication and lung function in a general adult population"
... medication within the last seven days before the examination was ascertained by an instrument for database-assisted online collection of medication data (IDOM) [19] The following substance classes ... other antihypertensive treatment is associated with reduced lung function in a general adult population Thus, our findings may serve as a basis for experimental testing, as for example by adding ... Greifswald, Greifswald, Germany 7Central Hospital of Augsburg, MONICA/KORA Myocardial Infarction Registry, Augsburg, Germany 8Ludwig-Maximilians-University, Institute of Medical Data Management,...
- 8
- 579
- 1
Tài liệu Báo cáo khoa học: Verprolin function in endocytosis and actin organization Roles of the Las17p (yeast WASP)-binding domain and a novel C-terminal actin-binding domain doc
... membrane and immunoblotted with an anti-actin mAb (left) Equivalent amounts of purified yeast actin were used in each binding assay and an amount representing 10% of the load used in each binding assay ... pAM237 pAM241 pAM252 pAM253 pAM872 pAM873 pAM874 pAM875 pAM876 pAM877 pAM878 pAM879 pAM880 pAM881 pAM882 pAM883 pAM884 pAM885 pAM886 pAM887 pAM888 pAM889 pAM890 pAM891 pAM892 pAM895 pAM896 pAM899 ... GFP-specific antiserum was a gift from J Kahana and P Silver (Dana Farber Cancer Center, Boston, MA) The anti-actin mAb was MAB1501 from Chemicon International (Temecula, CA) The anti-hexokinase rabbit...
- 23
- 679
- 0
Báo cáo Y học: Dystrobrevin requires a dystrophin-binding domain to function in Caenorhabditis elegans doc
... (and GST alone) after incubation with equal amounts of in vitro translated 35 S-labelled DYS-1 The signal intensity of the autoradiogram was quantitated with a radiographic analyser (Biorad) MW, ... the in vivo function of Dyb-1, we created transgenes Fig Yeast two-hybrid assay A plate containing SD media minus leucin, tryptophan and histidine was seeded with yeast carrying DNABD-Dys-1 and ... (typically 0–10 min) The reactions were stopped by adding EGTA to mM and heating at 65 °C for 10 DNA was purified on a Wizard column (Promega) and the action of BAL31 was checked by loading an aliquot...
- 6
- 334
- 0
Reproductive System Structure, Development and Function in Cephalopods with a New General Scale for Maturity Stages pot
... and appear granular Oocytes are at intercalary and protoplasmic growth phase AG are completely formed and usually white Gonad is large, usually dullwhite Spermatozoa accumulate in testis ampullae ... spermatophoric gland Stage VI Mature sexual cells pass through the accessory glands In all cephalopod females this stage occurs at spawning In males, spermatophores accumulate in the distal part ... female octopus, mucous egg mass of female squid and spermatophores of male squid Therefore, it seems inappropriate to include functional maturation and maturity in a single maturity stage (as in...
- 12
- 623
- 0
Báo cáo khoa học: An a-proteobacterial type malate dehydrogenase may complement LDH function in Plasmodium falciparum Cloning and biochemical characterization of the enzyme potx
... appropriate primers (Pf LDH: forward 5¢-ATGGCACCAAAAGCAAAAATCG-3¢ and reverse 5¢-AGCTAATGCCTTCATTCTCTTAG-3¢; Pf MQO forward 5¢-ATGATATGTGTTAAAAATATTTTG-3¢ and reverse 5¢-TCATAAATAATTAACGGGATATTCG-3¢) ... LEIVNLHA—-SPYVAPAAAIIEMAESYLKDLKKVLICSTLLE-G-QYGHSD-IFGGTPVV AEIIKLAK-ASAAFAPAAAITKMIKSYLYNENNLFTCAVYLN-G-HYNCSN-LFVGSTAK GEIVKLLKTGSAYYAPAASAIAMLESYLKDKRQILTCAAYLQ-G-EYDIHD-LYIGVPII AEIVGLLKTGSAYYAPAASAIEMAESYLKDKKRVLPCAAHLS-G-QYGVKD-MYVGVPTV ... NADP/NADPH as an alternate cofactor, having been tested up to maximum concentration of 100 mM A surprising observation was the use of acetyl pyridine adenine dinucleotide (APAD/ APADH) as an alternate...
- 15
- 508
- 0
Báo cáo khoa học: Myocyte enhancer factor 2B is involved in the inducible expression of NOX1⁄ NADPH oxidase, a vascular superoxide-producing enzyme ppt
... procedures Materials PGF 2a was purchased from Nacalai Tesque (Kyoto, Japan) Antibodies against MEF2 and ATF-1 were obtained from Santa Cruz Biotechnology (Santa Cruz, CA) PDGF-BB was obtained from PEPROTECH ... PKCdelta in vascular hypertrophy Biochem J 390, 761–767 11 Kuwano Y, Kawahara T, Yamamoto H, TeshimaKondo S, Tominaga K, Masuda K, Kishi K, Morita K & Rokutan K (2006) Interferon-gamma activates transcription ... Fujita T, Nagai R & Hirata Y (2002) Angiotensin II induces myocyte enhancer factor 2- and calcineurin ⁄ nuclear factor of activated T cell-dependent transcriptional activation in vascular myocytes...
- 9
- 452
- 0
Báo cáo hóa học: "IL-2 as a therapeutic target for the restoration of Foxp3+ regulatory T cell function in organ-specific autoimmunity: implications in pathophysiology and translation to human disease" doc
... T, Nakanishi K, Shimada A, Uga M, Kurihara S, Kawabata Y, et al: Genetic association between the interleukin-2 receptor-alpha gene and mode of onset of type diabetes in the Japanese population ... polymorphisms in the IL2RA gene are associated with age at diagnosis in late-onset Finnish type diabetes subjects Immunogenetics 2010, 62:101-107 36 Kawasaki E, Awata T, Ikegami H, Kobayashi T, Maruyama ... 13 Kumanogoh A, Wang X, Lee I, Watanabe C, Kamanaka M, Shi W, Yoshida K, Sato T, Habu S, Itoh M, et al: Increased T cell autoreactivity in the absence of CD40-CD40 ligand interactions: a role...
- 12
- 573
- 0
Báo cáo hóa học: " Dipolar cortico-muscular electrical stimulation: a novel method that enhances motor function in both - normal and spinal cord injured mice" pdf
... data from motor unit firing in humans and animals after SCI [46,47] and with results from intracellular recordings from sacrocaudal motoneurons that show a sustained and exaggerated firing rate ... descending brain-stem-released serotonin (5-HT) or noradrenalin [49-51] Here the increase in the spontaneous firing rate and the appearance of modulated activity in some animals after dCMS may indicate ... White matter staining Behavioral assessment At the end of each experiment, animals were injected with a lethal dose of Ketamine Two parts of the spinal column (including vertebrae and spinal cord)...
- 15
- 639
- 0
báo cáo hóa học: " A prospective study of decline in lung function in relation to welding emissions" pdf
... ever-welding Danish metal workers N Welders Mild steel Stainless steel Alloyed steel Aluminum All particulates manual metal arc (MMA) metal active gas (MAG) manual metal arc (MMA) tungsten inert gas ... 6.7 years Age at baseline was 17–30 years The overall annual decline in FEV1 was 11.1 ml Continuing smoking was associated with increased loss in FEV1 and atopy in smokers further increased the ... explain the apparent inconsistency Our data are similar to the findings of Beckett et al [10] They found an annual decline in FEV1 among welders of 40 ml and no overall excess decline in lung function...
- 8
- 437
- 0
báo cáo hóa học: " Lung function in asbestos-exposed workers, a systematic review and meta-analysis" pdf
... analysis DW, UM and MVG extracted and analysed the data All authors collaborated in interpreting the data and writing the manuscript and read and approved the final manuscript Page 14 of 16 10 11 12 ... of the included studies indicate that the radiological findings can only explain a small part of the variability in these parameters Other authors have also reported a medium to low explanatory ... occupational exposure to asbestos Only studies that applied an internationally accepted quality standard for lung function testing (i.e ATS standard, ERS standard) and that provided information about...
- 16
- 357
- 0
báo cáo hóa học:" Dynamic magnetic resonance imaging in assessing lung function in adolescent idiopathic scoliosis: a pilot study of comparison before and after posterior spinal fusion" doc
... Joint Surg Br 1985, 67(5):699-702 Kotani T, Minami S, Takahashi K, Isobe K, Nakata Y, Takaso M, Inoue M, Maruta T, Akazawa T, Ueda T, Moriya H: An analysis of chest wall and diaphragm motions in ... reformatted axial image Measurement of AP and TS diameter of the chest wall on the reformatted axial image (a) Upper level at the carina (C), maximal inspiratory image (b) Lower level at the apical vertebra ... Figure Measurement of diaphragmatic heights on the reformatted coronal image Measurement of diaphragmatic heights on the reformatted coronal image (a) At maximal inspiratory image and (b) maximal expiratory...
- 7
- 410
- 0
Báo cáo khoa học: "Relationship of cognitive function in patients with schizophrenia in remission to disability: a cross-sectional study in an Indian sample" pps
... Srinivasan L, Thara R, Tirupati SN: Cognitive dysfunction and associated factors in patients with chronic schizophrenia Indian J Psychiatry 2005, 47:139-143 Ananthanarayanan CV, Janakiramaiah N, Gangadhar ... Assessment Scale) – A Scale for Measuring and Quantifying Disability in Mental Disorders Chennai: Indian Psychiatric Society; 2002 American Psychiatric Association: Diagnostic and Statistical Manual of ... Trail making tests A and B Trail making tests A and B have been commonly used and validated in the Indian population [23] Trail shift scores were calculated by subtracting the time taken on Trail...
- 8
- 397
- 0
Báo cáo y học: " Kennedy Institute of Rheumatology Division, Imperial College London, 12–13 November 2003: Towards a molecular toolkit for studying lymphocyte function in inflammatory arthritis" ppt
... unfolds and that the peptidebinding groove can accommodate a peptide much longer than a nonamer Expression of HLA-B27 heavy chain in cells deficient in TAP (transporter associated with antigen ... (Birmingham University, UK) has characterised CD8+CD45RA+ cells found in rheumatoid synovial infiltrates Synovial CD8CD45RA+ cells are LFA-1high memory cells, containing Epstein–Barr virus tetramer ... are capable of recognising the HLA-B27 in this conformation Of great interest is the Available online http://arthritis-research.com/content/6/2/55 observation that homodimer tetramers also bind...
- 5
- 256
- 0
Báo cáo y học: "The shunt from the cyclooxygenase to lipoxygenase pathway in human osteoarthritic subchondral osteoblasts is linked with a variable expression of the 5-lipoxygenase-activating protein" doc
... Page of 10 (page number not for citation purposes) Materials and methods Patients and clinical parameters Tibial plateaux were dissected away from the remaining cartilage and trabecular bone under ... as described in the manufacturer's manual All determinations were performed in triplicate for each cell culture RNA extraction and RT-PCR assays Total cellular RNA from normal and OA osteoblasts ... an agarose gel and revealed by ultraviolet detection Densitometric analysis was performed for each amplimer against that for GAPDH with a ChemiImager 4000 (Alpha Innotech Corporation, San Leandro,...
- 10
- 459
- 0
Form And Function In A Legal System - A General Study Part 1 pdf
... implicit in what I have said so far The overall forms of functional legal units and the overall form of a legal system as a whole are, as Jhering plainly saw, of major theoretical and practical importance ... forms” that unduly sacrifice important values, as in the case of administrative agencies that have jurisdictional and structural features in which adjudicative and administrative functions are not ... components in legal analysis They are aware, too, of what, in an actual or potential legal achievement, should be credited at least partly to an appropriately formal feature of a rule, such as its...
- 43
- 252
- 0
Form And Function In A Legal System - A General Study Part 2 pps
... is analogous Just as the form of a table may be said to arrange and shape the wood, and the form of a citadel may be said to arrange and shape the building materials, and just as both can also ... survival of the fittest, and more subtle, at least in all ordinary and reasonably practical matters, than any you and I are likely to think up in our arm-chairs of an afternoon – the most favored alternative ... illuminating, they not qualify as a systematic general theory of the forms of functional legal units and their integration within a legal system As I have indicated, although the great German jurist,...
- 43
- 294
- 0
Form And Function In A Legal System - A General Study Part 3 ppsx
... operation, and instrumental capacity Legislative form may be manifest in a variety of ways: in institutional “blueprints,” in activities of institutional participants as duly organized, in accepted ... legislatures in political and in legal studies, and also in comparative institutional research, one may well ask whether anything is left here for an analyst concentrating on overall legislative ... of functional legal units that I deploy in this book I will also treat the main advantages of this form-oriented approach as the primary means for advancing understanding of functional legal...
- 43
- 244
- 0
Form And Function In A Legal System - A General Study Part 4 potx
... arbitrary They call for identifying and articulating reasons for and against alternative choices of form and content, and for the weighing and balancing of such reasons The overall form of a statutory ... explicit, usually in writing (or printing), and in appropriate grammar, syntax, and vocabulary of a common language of the system, at least when the rule is state-made, as opposed to privately made, ... society, act, and can be seen to act, as the lawful agency of all others in creating a statute A valid statute is therefore far more than a precept with a certain form and content It is a highly...
- 43
- 308
- 0
Form And Function In A Legal System - A General Study Part 5 ppsx
... regulation adopted by an administrative agency or official an opinion of an administrative agency creating, developing, or applying agency adjudicative law – an opinion of a court interpreting ... gaps in statutes, case law interpreting or filling gaps in administrative regulations, and case law as set forth in opinions of administrative adjudicators A chosen set of words in fixed verbal ... more than one instance A law could be highly simple, yet lack all generality, as with a statute passed for a special case, such as a law relieving a single business entity of a tax A law could...
- 43
- 301
- 0
Form And Function In A Legal System - A General Study Part 6 pptx
... individuals with the certainty that formal criteria of prima facie validity allow Again, this high certainty is an important value of the rule of law Indeed, in the usual case, contracting parties ... a large body of privately created law and rights that are valid not merely against prior original contracting parties, but against third parties generally Again, these accumulated rights may ... or, indeed, may even be led not to enter a particular proposed contract at all, given that an alternative appears preferable.19 Again, form is a factor that can leave deep and indelible imprints...
- 43
- 399
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ đặc tuyến hiệu suất h fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25