hemodynamics acid base homeostasis and oxygen transport variables
Báo cáo y học: "Mechanical ventilation using non-injurious ventilation settings causes lung injury in the absence of pre-existing lung injury in healthy mice" pdf
Ngày tải lên :
13/08/2014, 11:23
... B.V., Bladel, the Netherlands), mg/ml medetomidine (Pfizer Animal Health B.V., Capelle a/d IJssel, the Netherlands) and 0.5 mg/ml atropine (Pharmachemie, Haarlem, the Netherlands; KMA) Induction ... at 120 breaths/ minute and 70 breaths/minute with LVT and HVT, respectively; in BALB/c mice, respiratory rate was set at 100 breaths/ minute and 70 breaths/minute with LVT and HVT, respectively ... and fluid strategies Although blood gas analysis from LVT mice and HVT mice using normal saline revealed metabolic acidosis after five hours of MV (in C57Bl/6 mice pH with LVT = 7.17 ± 0.07 and...
- 11
- 463
- 0
Báo cáo sinh học: "Genetic parameters for lactation traits of milking ewes: protein content and composition, fat, somatic cells and individual laboratory cheese yield" ppt
Ngày tải lên :
14/08/2014, 13:21
... yield and fat content and a nonsignicant effect on protein fractions, LSCC and LILCY This result agrees with others on Churra [12,17,20] and Latxa [21] ewes for fat and protein contents and somatic ... environmental variables that were thought to affect milk yield and composition in the Churra breed conditions [11] There were four lambing age groups (1: between and yrs; 2: between and yrs; 3: between and ... casein and protein contents We must bear in mind that protein and casein contents had the highest and very close heritabilities and presented similar correlations with the rest of the variables...
- 16
- 316
- 0
Báo cáo y học: "MALDI-TOF MS Combined With Magnetic Beads for Detecting Serum Protein Biomarkers and Establishment of Boosting Decision Tree Model for Diagnosis of Colorectal Cancer"
Ngày tải lên :
25/10/2012, 11:18
... analysis Sample pretreatments and proteomic analysis in the proteomic profiling analysis, the serum samples from the diseased and control groups were randomized, and blinded to investigators Serum ... immunologic and biochemistry test But, the sensitivity and specificity of the current biomarkers in tumor diagnosis is low (usually less than 70%) and complicated by high return of ‘false-positives’ and ... studies were underway currently [12; 13]; however, a serum-based assay with equivalent sensitivity and specificity would be more feasible and acceptable to many patients A new method for diagnosing...
- 9
- 530
- 1
Tài liệu Báo cáo khoa học: Interaction between very-KIND Ras guanine exchange factor and microtubule-associated protein 2, and its role in dendrite growth – structure and function of the second kinase noncatalytic C-lobe domain docx
Ngày tải lên :
14/02/2014, 19:20
... CD2-1-6 (amino acids 702–767), CD2-1-7 (amino acids 668– 767), CD2-1-8 (amino acids 635–767), CD2-1-6-1 (amino acids 702–735), CD2-1-6-2 (amino acids 702–744) and CD2-1-6-3 (amino acids 702– 755) ... CD2-1 (amino acids 600–767) derivatives: CD2-1-1 (amino acids 600–634), CD2-1-2 (amino acids 600–667), CD2-1-3 (amino acids 600–701), CD2-1-4 (amino acids 600–734), CD2-1-5 (amino acids 735–767), ... into five subregions: KIND2-1 (amino acids 456–487), KIND2-2 (amino acids 456–521), KIND2-3 (amino acids 456–555), KIND2-4 (amino acids 488–620) and KIND2-5 (amino acids 589–620) These KIND2 subregions...
- 11
- 658
- 0
Tài liệu Báo cáo khoa học: SREBPs: protein interaction and SREBPs Ryuichiro Sato doc
Ngày tải lên :
18/02/2014, 13:20
... Rbx1, and one of a family of F-box proteins, Fbw7 [17] Glycogen synthase kinase-3b phosphorylates serine and ⁄ or threonine residues near the ubiquitination site in SREBP-1 and SREBP-2, and SREBP ... when their specific ligands are present, HNF-4 and LRH-1 appear to be exceptional, in that they are constitutively active in the abundance of their endogenous ligands, acyl-CoA and phospholipids, ... they are processed, and then transported into the nucleus In this pathway, two interact- Fig HNF-4 stimulates and LRH-1 suppresses the transcriptional activities of SREBP-1a and SREBP-2 HEK293...
- 6
- 589
- 1
Tài liệu Báo cáo khoa học: Combinatorial approaches to protein stability and structure pdf
Ngày tải lên :
19/02/2014, 12:20
... (2002) Random insertion and deletion of arbitrary number of bases for codonbased random mutation of DNAs Nat Biotechnol 20, 76–81 34 Wang, L., Brock, A., Herberich, B & Schultz, P.G (2001) Expanding ... 74 amino acids with four 14 residue randomized amphipathic helices, three turns of defined sequence (GPDSG, GPSGG and GPRSG), an initial Met-Gly and terminal Arg Remarkably, 29 of 48 randomly selected ... extensively randomized chorismate mutase, which is required for the biosynthesis of phenylalanine and tyrosine, and therefore amenable to selection on media lacking these amino acids [74–76]...
- 14
- 584
- 0
Tài liệu Báo cáo khoa học: The role of the SEA (sea urchin sperm protein, enterokinase and agrin) module in cleavage of membrane-tethered mucins pdf
Ngày tải lên :
19/02/2014, 18:20
... MUC3- and MUC12- cleavage sites and the MUC3 and MUC12 SEA domains All constructs were based on the MUC1FDTR backbone [18,13], and are illustrated in Fig Using unique PsiI (J05582: 3351) and DraIII ... when mutated to alanine, is located at the base of the loop and may interact with other residues in the adjacent b2 and b3 strands, affecting conformation and tightness of the loop Next to this phenylalanine, ... consists of three a-helices and six b-strands forming an a ⁄ b sandwich fold The FRPG ⁄ SVVV residues of the MUC1 cleavage site, which is located in a loop between b2 and b3 strands, are illustrated...
- 11
- 605
- 0
Tài liệu Báo cáo Y học: Control of p70 ribosomal protein S6 kinase and acetyl-CoA carboxylase by AMP-activated protein kinase and protein phosphatases in isolated hepatocytes pot
Ngày tải lên :
22/02/2014, 07:20
... involved in the control of ACC and p70S6K by amino acids and AMPK These mechanisms are shown schematically in Fig 8, based on the available data in the literature and integrating the results obtained ... between 45 and 60 of incubation (Fig 1) Like anoxia, both AICAr and oligomycin activated AMPK (Fig 2) and this activation was not changed in hepatocytes incubated with glutamine (Figs and 2) Under ... ACC and p70S6K under metabolic stress conditions Rapamycin and AICAr exert different effects on the activation of ACC and p70S6K induced by glutamine Rapamycin is a potent inhibitor of mTOR and...
- 9
- 455
- 0
Báo cáo khoa học: Muramyl-dipeptide-induced mitochondrial proton leak in macrophages is associated with upregulation of uncoupling protein 2 and the production of reactive oxygen and reactive nitrogen species docx
Ngày tải lên :
05/03/2014, 23:20
... these molecules with the level and function of UCP2 and free radical production in macrophages We find that MDP induces reactive oxygen and nitrogen species production and upregulates UCP2 protein ... demonstrate clearly the inability of MB and LPS to induce any impairment in mitochondrial function after h of treatment RCR and states 2, 3, and FCCP rates of MB- and LPStreated cells were the same ... vitamin E (100 lM) for 10 and then stimulated with MDP (100 lg) for h, and OÀ and NOÀ =NOÀ were measured as described in Experimental proce2 dures Results for OÀ (open bars) and total NO (black bars)...
- 11
- 430
- 0
Báo cáo khoa học: Concepts and tools to exploit the potential of bacterial inclusion bodies in protein science and biotechnology pdf
Ngày tải lên :
06/03/2014, 00:20
... spectrum and each peak can be assigned according to its wavenumber For instance, in water a-helices and random coils absorb between 1660 and 1648 cm)1, intramolecular b-sheets between 1640 and 1623 ... young and with higher growth rate) and an IB-containing one that will grow more slowly [13] Potential of bacterial inclusion bodies Fig Protein biosynthesis and aggregation under normal and stress ... products due to translation errors and misfolding are handled by the quality control system, composed of refolding chaperones and proteases The system is energetically demanding (most processes are ATP-dependent)...
- 11
- 584
- 0
Báo cáo khoa học: Protein aggregation and amyloid fibril formation prediction software from primary sequence: towards controlling the formation of bacterial inclusion bodies pot
Ngày tải lên :
06/03/2014, 00:20
... a-helices and b-strands – using the consensus secondary structure prediction program secstr [27] and Zibaee et al [24] looked for b-contiguity, essentially a derivative of b-strand propensity based ... a-helix and b-sheet) that can serve as the nucleating core of amyloid fibril formation The algorithm betascan [35] calculates likelihood scores for potential b-strands and strand-pairs based 2430 ... properties of amino acid sequences to calculate aggregation propensities, while Tartaglia et al [25] and Fernandez-Escamilla et al [14] additionally include the effect of environmental variables in...
- 8
- 415
- 0
Báo cáo khoa học: Interaction of the general transcription factor TnrA with the PII-like protein GlnK and glutamine synthetase in Bacillus subtilis potx
Ngày tải lên :
06/03/2014, 00:21
... exponential growth phase, and the cells were then washed and resuspended in SMM without nitrate, and finally incubated for a further 20 Samples were taken before and after the shift, and soluble cell-free ... C-terminus of TnrA, and may play a role in the regulation of TnrA activity and its proteolysis [15] To test this assumption, various truncations of TnrA (lacking six, 20 and 35 amino acids from the ... amino acids still bound to GlnK; however, removal of 35 amino acids completely abolished binding of GlnK (Fig 6A,C) This result implies that a region in TnrA located between 20 and 35 amino acids...
- 11
- 596
- 0
Báo cáo khoa học: Protein–protein interactions and selection: yeast-based approaches that exploit guanine nucleotide-binding protein signaling doc
Ngày tải lên :
06/03/2014, 11:20
... signaling-based systems, which require the incubation of yeast cells at suboptimal temperatures (25 and 36 °C), and the monitoring or discrimination of the signaling changes through quantitative and ... example, interactions of attractive drug target candidates, syntaxin 1a and nSec1 or fibroblast-derived growth factor receptor and SNT-1, were monitored, and nSec1 mutants that lost the ability to bind ... pharmaceutical targets of GPCRs Yeast-based and signaling-mediated screening systems are obviously powerful and practical tools with which to quickly screen for possible candidates In the future, we can...
- 14
- 443
- 0
Báo cáo khoa học: Protein–protein interactions and selection: generation of molecule-binding proteins on the basis of tertiary structural information potx
Ngày tải lên :
06/03/2014, 11:20
... CDRs of heavy chain and CDR3 of light chain [ref 39] Fv Randomization in CDR loops of heavy and light chains Y/S library in BC, DE and FG loops 10 FN3 Randomization in BC, DE and FG loops Fig Local ... (XGGGS)n in which the X residues were randomized and the linker length (n) was intermittently varied (B) DARPin: six amino acids in the loop and helix structures are randomized (C) A-domains: variable ... amino acids in native CDR loops have been constructed on one or more frameworks [36,37] Recently, amino acid- restricted libraries, in which CDR loops were randomized using only the amino acids...
- 9
- 505
- 0
Báo cáo khoa học: Functional analysis of a murine monoclonal antibody against the repetitive region of the fibronectin-binding adhesins fibronectin-binding protein A and fibronectin-binding protein B from Staphylococcus aureus pot
Ngày tải lên :
06/03/2014, 22:21
... fibronectin (Fn), and use these as a bridge between the bacterial surface and host cell receptors [12] S aureus MSCRAMMs that bind to collagen, Fn and fibrinogen have been identified and characterized ... form in body fluids and in an insoluble, fibrillar form in the extracellular matrix Its main functions include cell adhesion and spreading, regulation of cell shape and migration, and differentiation ... and functional features of the Fn-binding moieties of FnBPA and FnBPB NYQFGGHNSVDFEEDTLPQVSGHNEGQQTIEEDTTP High-affinity binding sites for full-length Fn and its N-terminal fragment in FnBPA and...
- 16
- 560
- 0
Báo cáo khoa học: NMR and molecular dynamics studies of an autoimmune myelin basic protein peptide and its antagonist Structural implications for the MHC II (I-Au)–peptide complex from docking calculations ppt
Ngày tải lên :
07/03/2014, 16:20
... various systems comprised 3899 and 4516 SPC molecules for the agonist and the antagonist in water, respectively, and 817 and 927 Me2SO molecules for the agonist and the antagonist, respectively, ... [82] and (B) sequence alignment of the Vb chain TCR(79–83), MBP(74–85) and MBP(95–103) P5 and P8 are prominent, solvent-exposed TCR contact residues of the MBP(86–105) peptide, and P4, P6 and ... in Me2SO, 98 sequential and medium-range NOEs and two long-range NOEs were used as distance restraints, whereas, in aqueous solution, 116 sequential and mediumrange NOEs and two long-range NOEs...
- 15
- 447
- 0
Báo cáo khoa học: "Age Prediction in Blogs: A Study of Style, Content, and Online Behavior in Pre- and Post-Social Media Generations" ppt
Ngày tải lên :
07/03/2014, 22:20
... identification (Herring and Paolillo, 2006; Yan and Yan, 2006; Nowson and Oberlander, 2006) Herring et al (2006) found that the typical gender related features were based on genre and independent of ... this study is based on blogs updated in 2009-10 which is 5-6 years later and thus, the 13-17 age group is now 18-22 and so on We use style-based (lexical-stylistic) and content-based features ... Raghavan, and Andrew Tomkins 2004 Structure and evolution of blogspace Commun ACM, 47:35–39, December Amanda Lenhart, Kristen Purcell, Aaron Smith, and Kathryn Zickuhr 2010 Social media and young...
- 10
- 540
- 1
Báo cáo khoa học: NBR1 interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB) and shows developmentally restricted expression in the neural tube pptx
Ngày tải lên :
08/03/2014, 10:20
... regions of amino acids 248±360 and 248±349 (Y214 and Y156, respectively), and the C-terminal amino acids 370±392 (Y163) Clone Y198 encoded the full-length cDNA of the calcium and integrin binding ... 1±333), pGBT9NBR1c1 (amino acids 340±453), pGBT9NBR1c2 (amino acids 451±597), pGBT9NBR1c3 (amino acids 592±754) and pGBT9NBR1c4 (amino acids 748±910) A BclI fragment of pGBT9NBR1 was subcloned into ... PCR ampli®ed and subcloned into the pGBT9 vector EcoRI site to give the following constructs: pGBT9NBR1216 (amino acids 1±216), pGBT9NBR1333 (amino acids 1±333), pGBT9NBR1c1 (amino acids 340±453),...
- 8
- 421
- 0
Báo cáo khoa học: Biochemical properties of the human guanylate binding protein 5 and a tumor-specific truncated splice variant Mark Wehner and Christian Herrmann doc
Ngày tải lên :
15/03/2014, 10:20
... Biophysical properties of hGBP5a ⁄ b and hGBP5ta M Wehner and C Herrmann hand, interact dynamically with the bound nucleotide, and usually bind nucleotides in the micromolar range ... cooperativity in specific activity, with Hill coefficients of 2.4 and 1.9 and dissociation constants (KdHill) of and lm for hGBP5a ⁄ b and hGBP5ta, respectively The proteins are very similar in terms ... found comparable dissociation constants for GDP and GppNHp [guanosine 5¢-(b,c-imino)-triphosphate], with Kd values of 11 and lm for hGBP5ta and 7.2 and 2.6 lm for hGBP5a ⁄ b, respectively For the...
- 9
- 462
- 0
Báo cáo khoa học: pyr RNA binding to the Bacillus caldolyticus PyrR attenuation protein – characterization and regulation by uridine and guanosine nucleotides potx
Ngày tải lên :
16/03/2014, 06:20
... BcBL2 and BcBL3, and the effects of nucleotides on RNA binding A rapid and convenient filter binding assay [14] was used for many of these experiments Electrophoretic mobility shift assays and sedimentation ... and PRPP) or inhibition (GMP and GTP) of binding of PyrR to BcBL1 and BcBL2 Data are the average of at least two independent determinations To learn more about how PyrR distinguishes purine and ... was determined from both sedimentation velocity and equilibrium sedimentation experiments at high and low protein concentrations and in the presence and absence of 0.1 m NaCl The results of the...
- 16
- 309
- 0