fringe projection for in vivo topometry

... selenocysteine residue in a C-terminal Sel-tag [18] Der p carrying the Sel-tag had an intact core sequence and maintained allergen-specific IgE-binding epitopes and the use of a Sel-tag enabled labelling ... inhalation In this study, we tracked inhaled Der p in vivo using the recently developed Sel-tag method in a mouse model for Der p 2-sensitization Based upon our findings we conclude that the in ammatory ... In vivo tracking of 75 Se-labelled Der p intrinsic biological properties of the allergens may all contribute to their allergenicity [1–4] The intrinsic properties required for evoking an...

Ngày tải lên: 07/03/2014, 21:20

... bacterial dsbB protein in the periplasm also contains two cysteine pairs acting in concert for the transfer of disulfides to dsbA [25] Interestingly, the redox function of dsbB is linked to the bacterial ... motif Therefore the systematic functional analysis of the six cysteines in yeast Erv1p was the major goal of this paper All three pairs of cysteines in Erv1p are indispensable for in vivo activity ... cysteines of yeast Erv1p can be grouped into three pairs (Fig 1): one pair near the N-terminus of the protein, the central pair close to the FAD binding motif and two cysteines in the C-terminal...

Ngày tải lên: 17/03/2014, 10:20

... eventually translate QDs for use in clinical applications such as in vivo imaging in human subjects Modeling studies have revealed that two spectral windows exist for QD imaging in living subjects, one ... exhibited high affinity integrin avb3 specific binding in cell culture and ex vivo In vivo NIR fluorescence (NIRF) imaging was carried out on athymic nude mice bearing subcutaneous integrin avb3-positive ... NIR region In a recent study, QDs were linked to anti-AFP (alphafetoprotein, a marker for hepatocellular carcinoma cell lines) antibody for in vivo tumor targeting and imaging [174] No in vitro...

Ngày tải lên: 22/06/2014, 18:20

... al: In vivo near-infrared fluorescence imaging of integrin ¦Á v ¦Â in an orthotopic glioblastoma model Molecular Imaging and Biology 2006, 8:315-323 21 Sato A, Klaunberg B, Tolwani R: In vivo ... shown in Figure 8, after injecting the nanoprobes, a significant change in signal intensity was observed in some regions of tumors, indicating that there existed accumulation of the nanoprobes in ... cancer of mm in diameter and IVIS imaging system and Magnetic Resonance Imaging, investigated the feasibility of as-prepared nanoprobes for non-invasive in vivo targeted dual modal imaging of gastric...

Ngày tải lên: 11/08/2014, 00:23

... as a high affinity binding site for Gag The resulting RNAprotein complex is then targeted to the plasma membrane where virion budding takes place Poly A pol ∆ Env RRE Figure packaging constructs ... transfer to the brain of primates for treatment of experimentally induced Parkinson's disease [6] Packaging of unspliced vector mRNA in the producer cell line is a key part in process of lentiviral ... The dotted line indicates a deletion damaged areas of the brain Such cells have the potential to be useful for the treatment of Parkinson's disease, spinal cord injury and other inflammatory...

Ngày tải lên: 13/08/2014, 09:21

... reduction in hepatic sinusoidal HbsO2 during the early stages of systemic inflammation In parallel, we detected an increasing NAD(P)H autofluorescence representing an intracellular inadequate ... requires changing the continuous intravenous infusion rates of the dye to provide stable plasma concentrations With mice (increasingly used as laboratory animals) there is a growing need for a method ... represents a simple and reliable method for hepatic sinusoidal HbsO2 determination in small rodents In combination with NAD(P)H autofluorescence, it provides information on the oxygen distribution,...

Ngày tải lên: 13/08/2014, 13:20

... enzyme of interest should be investigated in the context of the in vivo- like medium Finally, in vivo, the enzymes are present at much higher concentrations than in typical enzyme assays, in which ... at least three independent cell-free extracts from steady-state samples from a single chemostat culture Enzyme In vivo- like Vmax (mmolÆmin)1Æg protein)1) Flux (mmolÆmin)1Æg protein)1) HXK PGI ... converted per minute per milligram of extracted protein Protein determination was carried out with the bicinchoninic acid kit (BCA Protein Assay Kit; Pierce, Thermo Fisher Scientific, Rockford, IL,...

Ngày tải lên: 06/03/2014, 09:22

... function of the increasingly large group of proteins that have been shown to contain intrinsically unstructured regions The intrinsic conformation flexibility that is inherent in this binding mechanism ... Protein A Agarose ⁄ Salmon Sperm DNA incubation for no more than h Beads were washed twice for 15 in lysis buffer containing 150 mm NaCl, followed by a 15-min wash in lysis buffer containing 500 ... min), in strain YPP310 (light grey bars, DDABDswi1 + snf5) lacking both activator-binding domains (SWI1D329-655, SNF5D2-327), strain YPP211 (white bars, DABDsnf5) lacking the Snf5 activator-binding...

Ngày tải lên: 07/03/2014, 00:20

... Kokubo T (2001) Mutations in the TATA-binding protein, affecting transcriptional activation, show synthetic lethality with the TAF145 gene lacking the TAF N-terminal domain in Saccharomyces cerevisiae ... biogenesis complex, involved in mRNP formation, show the lowest GLAM ratios measured in this work This is not the case in other RNA processing mutants that have been analyzed in this work In agreement ... timeconsuming and not easy to carry out in a high number of samples In addition, the information obtained by nuclear run-on shows the location of active polymerases, but it gives no information...

Ngày tải lên: 07/03/2014, 12:20

... GPVI and integrin a2b1 binding sites Aegyptin effectively inhibits carotid thrombus formation in vivo Results Aegyptin has an elongated structure Aegyptin is a collagen-binding protein from the ... Aegyptin binds with high affinity to the vWF binding site in collagen, independently of hydroxyproline In an attempt to identify the binding sites involved in collagen interaction with aegyptin, ... sufficient for the interaction Aegyptin binds with low affinity to GPVI and integrin a2b1 binding sites in collagen Sequences involved in collagen interaction with GPVI and integrin a2b1 were tested...

Ngày tải lên: 22/03/2014, 21:20

... ‘contaminants’ in the process of searching binding proteins, the in vivo evidence for the relationship between ROCO proteins and cytoskeletons in D discoideum suggests a need to further investigate ... various model systems, including lower eukaryotes and invertebrates, in order to obtain clues for building important hypotheses The rapidity and efficiency of in vivo studies in many nonmammal models ... proteins in dendrites depends on AP-1 clathrin adaptor, which is known to be involved in dendritic transport, but not on Unc104 kinesin, a motor protein required for axonal transport Therefore,...

Ngày tải lên: 23/03/2014, 04:20

... at defining the quality of digital projection as the minimum equivalent to the one in 35 mm (on positive film) The minimum resolution that has served to define digital cinema projection since ... Passive wheel gain machine 3D system for use in one filter Anti-theft tag on the auditorium technology) glasses Training for installation required Light consuming Active XPAND Active Infrared Matt ... intersect in one and the same straight line“ Hence, the Scheimpflug principle consists in keeping the three planes at a maximum in parallel Screen file: This is the file that contains the information...

Ngày tải lên: 30/03/2014, 14:20

... Additional techniques for assessing in- vivo PF joint motion have included dynamic CT imaging [34] and single-plane fluoroscopic imaging combined with shape matching [35] Dynamic CT imaging has limitations ... have grown in popularity as a tool for measuring PF joint motion under in- vivo conditions These techniques – which have been described by various names, including kinematic MRI [27-29], cine phase ... limitations associated with existing methods for measuring PF joint motion, our laboratory has developed a new model-based tracking technique for measuring in- vivo 3D joint motion The purpose of the...

Ngày tải lên: 20/06/2014, 01:20

... feasibility of detecting several forms of femoral implant loosening, in vitro and in vivo using techniques based on harmonic distortion [16-19] http://www.josr-online.com/content/4/1/10 In vitro, the ... system for intra operative manufacturing and stability testing of hip prostheses In Proceedings of TEHNOMUS XIII, the 13th International conference on New technologies and products in machine manufacturing ... graphs corresponding to the insertion stages and canal and reinserting the prosthesis The FRF had a normal evolution during the reinsertion and the graphs corresponding to the final two stages,...

Ngày tải lên: 20/06/2014, 01:20

... cells in 0.2 mL of media containing 20% Matrigel ™(Becton Dickinson, Bedford, MA, USA) or intraperitoneal (i.p.) injections of × 10 cells in mL of media Animals bearing s.c tumors were used for ... colorectal carcinoma with disease progression while on or following fluoropyrimidine-, oxaliplatin-, or irinotecan-containing chemotherapy regimens [22] Panitumumab has been well tolerated in clinical ... 18.6 h for the i.v injected group and 19.3 h for the i.p.-injected group In contrast to the i.v.- injected sets of mice, the clearance (T1/2b phase) of the RIC following i.p injection in the...

Ngày tải lên: 21/06/2014, 02:20

... affinity and infusion ability of CG-HVJ-E in tumor cells CG-HVJ-E containing Qdot had a higher affinity for tumor cells than Qdot alone or HVJ-E containing Qdot (Figure 2A) CG-HVJ-E containing ... systemic administration of HVJ-E complexes Indications of systemic injury were recorded, including serum levels of total bilirubin (T Bil), aspartate aminotransferase (AST), and alanine aminotransferase ... of in vivo selection procedures, were used because of their high potential for metastasizing to the liver [26,27] The cells were maintained in D-MEM (Sigma Aldrich Japan, Tokyo, Japan) containing...

Ngày tải lên: 09/08/2014, 09:20

... residue at the C-terminus of the intein to form succinimide [26], leading to excision of the intein and ligation of the exteins Inteins have been widely used for in vitro protein semi-synthesis ... peptide (DnaE IC-Biotin) and biotinylated N-terminus DnaB mini-intein peptide (Biotin-DnaB IN) The 47 amino acid peptide sequence of the C-terminus DnaE intein peptide (DnaE IC-Biotin): MVKVIGRRSLGVQRIFDIGLPQDHNFLLANGAIAANCFDYKDDDDK(Ahx-Biotin)G ... at the C-terminus In order to put a biotin at the N-terminus of DnaB intein, it was necessary to add three extra Lys, at the N-terminus Lysines serve as a linking point for biotin as well as...

Ngày tải lên: 11/08/2014, 00:23

... Excellent Vehicle for Site Directed in- vivo Delivery of Drugs and Vaccines Anil Mahapatro1 and Dinesh K Singh2* Bioengineering Program & Department of Industrial and Manufacturing Engineering, Wichita ... materials and resources used in this study AUTHORS INFORMATION AM: is an assistant professor of Bioengineering in the Department of Industrial and Manufacturing Engineering at Wichita State University, ... high loading capacity for the drugs The high loading ability of NPs reduces the amount of the polymer carrier required for vaccine/drug delivery in the body The loading of drugs/vaccine into/onto...

Ngày tải lên: 11/08/2014, 08:20

... Fifty goslings were randomly divided into groups In brief, a group of 40 goslings were orally infected with GPV CHV strain, using 0.1 mL of 103 LD50 per gosling Another group of 10 goslings was ... experiments conducted during this study conform to the principles outlined by the Animal Welfare Act and the National Institutes of Health guidelines for the care and use of animals in biomedical research ... Sciences in Sichuan Agricultural University, China Animals were bred and maintained in an accredited facility at the Institute of Poultry Sciences in Sichuan Agricultural University (Sichuan, China),...

Ngày tải lên: 12/08/2014, 04:20

... enriched in minor Lhc proteins, were less affected in their Chl a/b ratio Photoprotection and carotenoid triplet formation in lutein vs violaxanthin-binding Lhc proteins Strong illumination of ... resistance was found in WT band 3, containing trimeric LHCII, while band 2, containing mostly minor Lhcbs, was more prone to photobleaching in agreement with previous findings [23] In the case of band ... shown also for the npq2lut2.1 mutant [37] Violaxanthin-binding LHCII monomers have the same stability to heat denaturation as lutein-binding monomers, implying that binding of violaxanthin impairs...

Ngày tải lên: 12/08/2014, 05:20