figure 6 5 group v
Optimization of 293 HEK suspension cultures for adenovirus production
... Genes (Figure 6. 5, group II) 99 TCA Cycle and Electron Transport Chain Genes (Figure 6. 5, group III) 100 Glycolysis Genes (Figure 6. 5, group V) 102 Cell Cycle Genes (Figure ... PF-CDM in Shake Flask 75 5.4 Cell Growth and Metabolism in PF-CDM Batch and Fed-batch Cultures 75 iv 5. 5 5 .6 Summary of Cell Growth and Virus Productivity 81 5. 7 Virus Production in PF-CDM ... 6. 2.3 6. 2.4 6. 2 .5 6. 2 .6 6.3 Ontological Distribution of Significantly Regulated Genes 86 Clustering of Significantly Regulated Genes 89 Amino Acid Metabolism Genes (Figure 6. 5, group...
Ngày tải lên: 15/09/2015, 17:09
Báo cáo y học: "Relationship between Anti-CCP Antibodies and Oxidant and Anti-Oxidant Activity in Patients with Rheumatoid Arthrit"
... 25 24 25 24 25 24 25 24 25 Serum GSHpx (U/ml) Mean 0.47 0.48 14.10 15 .63 0.11 0.13 114.23 112.21 3.34 3 .52 50 .39 53 .63 0 .64 0 .62 67 .44 71.13 Std Deviation 0. 25 0.19 6. 67 4.39 0.03 0.01 21. 15 ... positive Synovial MPO (U/ml) negative positive N Mean Std Deviation p value 24 25 24 25 24 25 24 25 0.072 0.074 0.1 56 0.1 45 2. 852 4 .59 2 3.134 4.783 0.027 0.032 0.088 0.0 86 0 .50 9 0.780 2.1 25 2 . 65 4 0.432 ... Anti-CCP(+) (n= 25) (mean ±SD) 54 .4 ± 9 .6 18/7 24 .5 1.4 9 .6 ± 6. 3 34.7 ± 33 .6 5. 7 ± 5. 2 4.1± 1.8 37.9 ± 26. 8 34.3 ± 23.8 Anti-CCP(-) (n=24) (mean ±SD) 56 . 2 ± 11.2 19 /5 25. 3±1.9 8.1 ± 7 .5 17.8 ± 23 .5 2.8±...
Ngày tải lên: 25/10/2012, 11:15
Báo cáo y học: "Serum cholesterol concentration associated with aspirin esterase activity in older people: preliminary data"
... pre- and post-interventional values of respective measured variables The level changes were calculated by subtracting the pre-interventional values from the post-intervention values A single linear ... other measured variables between pre- and post-intervention were unchanged at statistical significant levels: 5. 7 ± 1.1 to 5. 8 ± 1.1 mmol/L in total cholesterol, 5 .6 ± 0.8 to 5. 5 ± 1.1 mmol/L ... -0.2 76 (0. 268 ) Sex (men) 0. 352 (0. 152 ) Δ Body mass index (kg/m2) -0. 154 (0 .54 2) Δ Total cholesterol (mmol/L) 0 .54 2 (0.020)* Δ Glucose (mmol/L) 0.249 (0.320) β (P value) -0.389 (0.100) 0.3 06 (0.173)...
Ngày tải lên: 26/10/2012, 09:39
Báo cáo y học: "Matrix Metalloproteinase Activity in Pediatric Acute Lung Injur"
... activities in virus-induced ALI compared with non-viral ALI We found insignificant elevations in total MMP-8 and activities in subjects with viral ALI (RSV=4, Parainfluenza=2) compared to non-viral ... isoforms Figure 6: Active and total MMP-8 and MMP-9 levels in ALI with disease progression 6A Mean (± SEM) MMP-8 activity is shown for subjects who developed prolonged ALI (all subjects requiring ventilatory ... 2000; 1 05: 900-9 05 Prikk K, Maisi P, Pirila E, et al Airway obstruction correlates with collagenase-2 (MMP-8) expression and activation in bronchial asthma Lab Invest 2002; 82: 153 5- 154 5 Betsuyaku...
Ngày tải lên: 03/11/2012, 11:48
Tài liệu Sport and Physical Activity in Children with Congenital Heart Disease ppt
... 1993; 2: 55 66 e5 Kaminer SJ, Hixon RL, Strong WB: Evaluation and recommendations for participation in athletics for children with heart disease Curr Opin Pediatr 19 95; 7: 59 5 60 0 e6 Graf C, ... findings) 1.3; 5. 1; 5. 2; 5. 3 No competitive sports D Severe (remaining) findings 1.4a; 1.4b; 3; 4.1; 5. 4; (6) Limited sports E Vitally threatening findings Dtsch Arztebl 2007; 104(9): A 56 3 –9 ⏐ www.aerzteblatt.de ... corrective surgery to close the ventricular defect and valvulotomy of the pulmonary valve, may be close to normal Another child with Fallot's tetralogy may, however, have significant right ventricular...
Ngày tải lên: 12/02/2014, 19:20
Tài liệu Báo cáo khoa học: Exposure of IgG to an acidic environment results in molecular modifications and in enhanced protective activity in sepsis doc
... immunoglobulins Scand J Immunol 65 , 230–239 Dimitrov JD, Ivanovska ND, Lacroix-Desmazes S, Doltchinkova VR, Kaveri SV & Vassilev TL (20 06) Ferrous ions and reactive oxygen species increase antigen-binding ... Tchorbanov A, Pashov A & Vassilev T (20 05) The autoreactivity of therapeutic intravenous immunoglobulin (IVIG) preparations depends on the fractionation methods used Scand J Immunol 61 , 357 – 363 Notkins ... 2 253 –2 262 Dimitrov J, Roumenina L, Doltchinkova V, Mihaylova N, Lacroix-Desmazes S, Kaveri S & Vassilev T (2007) Antibodies use heme as a cofactor to extend their pathogen elimination activity...
Ngày tải lên: 16/02/2014, 15:20
Tài liệu Báo cáo khoa học: Mouse recombinant protein C variants with enhanced membrane affinity and hyper-anticoagulant activity in mouse plasma pptx
... IV Mutant V Mutant VI Mutant VII 0-10-90 20-10-70 nM g – 7. 26 5. 55 0 .66 1.32 7.10 2. 05 7.47 2 .55 – NAd NA 2. 45 8.70 NA 8.40 NA 8.77 – 8.77 4. 96 0 .67 1.44 6. 79 2.28 5. 99 2 .67 2 76 241 1 05 1 65 15 ... ± 0 .50 c 0. 26 0.04 0. 16 0.71 0.20 0. 46 0. 25 ± 0.13 ± 0.98 ± 1. 15 ± 0. 75 ± ± ± ± ± ± ± ± 0. 75 0. 16 0. 05 0.18 0. 45 0.17 0. 45 0.23 ± ± ± ± ± ± ± ± ± 32 20 28 25 18 18 26 56 7 7 53 80 2813 737 65 8 4094 ... protein C for mouse (NP_032 960 .2), human (NP_000303.1), rat (NP_0 369 35. 1), bovine (XP _58 5990.3) and human prothrombin (NP_000497.1) 65 88 FEBS Journal 2 76 (2009) 65 86 66 02 ª 2009 The Authors Journal...
Ngày tải lên: 18/02/2014, 06:20
Tài liệu An Empirical Analysis of Political Activity in Hollywood pptx
... Kevin Bacon Total Contributions 3 96, 000 76, 450 73,000 64 ,50 0 61 ,000 60 ,000 57 ,50 0 57 ,50 0 53 ,000 35, 000 34 ,50 0 30 ,50 0 30,000 29,000 27,000 25, 400 25, 000 24,000 19 ,50 0 18 ,50 0 18,000 16, 50 0 15, 500 ... dev of box office returns (mil $) St dev of box office returns, starring roles (mil $) 36. 85 22. 15 48. 56 35. 32 37 .52 24.83 168 .09 1 06. 27 166 .99 1 26. 80 1 36. 01 97. 45 49.49 28 .63 52 .01 36. 42 45. 24 ... (conditional on giving) Female Actors St Dev 0.27 Directors and Producers Mean St Dev 0. 56 $7,890 .57 $28 ,60 0. 35 $13,318.82 $ 45 ,66 0. 96 $1, 250 . 76 $1 ,61 9. 95 $1,231.23 $1 ,69 4 .69 0. 36 0.07 Age on 1/1/2001...
Ngày tải lên: 19/02/2014, 10:20
Tài liệu Visual Activity in Hollywood Film: 1935 to 2005 and Beyond docx
... 4.4 4.3 4.0 6. 3 7.0 3.8 3.4 4 .6 32 .6 7.8 5. 9 3.0 45. 0 13.9 7 .6 4.8 11.8 3.1 11.3 9.2 0 .5 76 0.290 0.3 56 0. 354 0.219 0.384 0.377 0.1 96 0.4 35 0.390 0.240 0. 257 0.249 0.297 0.199 0.173 0. 160 0.199 0.190 ... Junkanoo festival escape Underwater fight in wetsuits Castle circus and escape 24.4 0 .6 10 .5 66 .7 90.8 57 .7 83.9 58 .2 75. 7 104.1 69 .6 101.7 23.3 91.9 70.9 100.7 42.7 94.2 97 .6 85. 9 111.9 74.0 ... some- Figure A scatter plot of whole-film visual activity indices (VAIs) by year for 1 45 films from 19 35 to 20 05 VISUAL ACTIVITY IN HOLLYWOOD FILM Figure Scatter plots of whole-film visual activity...
Ngày tải lên: 19/02/2014, 14:20
Tài liệu Báo cáo khoa học: Polarized distribution of inducible nitric oxide synthase regulates activity in intestinal epithelial cells pdf
... 1 25 mm NaCl; 1% (v ⁄ v) TX-100; 1% (v ⁄ v) TX-100 in the presence of 1 25 mm NaCl; (c) resuspension in 0.17 m sucrose, 30% (v ⁄ v) glycerol, 10 mm glycine buffer, pH 8.0, containing 0. 25% (v ⁄ v) ... location of nitrogen oxide synthases in RAW 264 .7 macrophages Mol Pharmacol 41, 61 5 62 4 10 Vodovotz Y, Russell D, Xie Q, Bogdan C & Nathan C (19 95) Vesicle membrane association of nitric oxide ... Chem 2 76, 4 464 7–4 4 65 2 Mergia E, Russwurm M, Zoidl G & Koesling D (2003) Major occurrence of the new alpha(2)beta(1) isoform of NO-sensitive guanylyl cyclase in brain Cell Signal 15, 189–1 95 452 M...
Ngày tải lên: 19/02/2014, 16:20
Tài liệu Báo cáo khoa học: Experimental proof for a signal peptidase I like activity in Mycoplasma pneumoniae, but absence of a gene encoding a conserved bacterial type I SPase pdf
... (70–80) VGDTK(+1 36) XVAXVR (70–80) VGDTK(+1 36) XVAXVR (70–80) VGDTK(+1 36) XVAXVR (70–80) VGDTKXVAXVR (70–80) RVGDTKXVAXVR (69 –80) ATWVFER (1 46 152 ) ATW(ox)VFER (1 46 152 ) ATW(2 · ox)VFER (1 46 152 ) TLQDLXVEQPVTPYTPNAGLAR ... 13 25 .6 907.4 923.4 939.4 23 95. 5 2490.2 2489.2 N(+1 36) TYLLQDHNTLTPYTPFTTPXDGGXDVVR ( 26 54 ) N(+1 36) TYLLQDHNTLTPYTPFTTPXDGGXDVVR ( 26 54 ) N(+1 36) TYLLQDHNTLTPYTPFTTPXDGGXDVVR ( 26 54 ) VGDTK(+1 36) XVAXVR ... ⁄ z-value Rel mol mass Sequence (position) Remarks 850 .2 855 .7 859 .7 4 36. 3 65 3.9 443 .6 448.9 444.2 66 3.8 454 .7 462 .7 470.7 799 .5 831.1 62 3.3 33 96. 6 3418 .6 3434 .6 13 05. 9 13 05. 7 1327.7 1343 .6 1329.7...
Ngày tải lên: 19/02/2014, 18:20
Tài liệu Báo cáo khoa học: "Mining metalinguistic activity in corpora to create lexical resources using Information Extraction techniques: the MOP system" doc
... 0. 85 0.98 IISMax W 31 86 0. 86 0.87 0. 95 GISMax W 3188 0. 86 0.87 0. 95 NB T 1 36 0.88 0.97 0.84 NB T 794 0.87 0. 96 0.84 NB W 4290 0.73 0. 86 0.77 F NB (3/W) IIS (3/W) R GIS (1/W) P 0 .6 0 . 65 0.7 0. 75 ... Precision W 1 254 0.97 0. 96 0.98 IISMax T 1 36 0. 95 0. 96 0.94 IISMax W 1 252 0.92 0.97 0.9 GISMax T 138 0.91 0.9 0. 96 GISMax T 7 96 0.88 0.93 0.92 IISMax T 794 0. 86 0. 95 0.89 IISMax W 4290 0.87 0. 85 0.98 ... verbs, our metrics show precision and recall rates of around 0.97, and an overall F-measure of 0.97 .6 Of 55 81 sentences ( 96 of which were metalinguistic sentences signaled by our cluster of verbs),...
Ngày tải lên: 20/02/2014, 15:20
Tài liệu Báo cáo khoa học: The molecular surface of proteolytic enzymes has an important role in stability of the enzymatic activity in extraordinary environments pptx
... KAYASGIVVVAAAGNSGSSGSQNTIGYPAKYDSVIAVGAVDSNKNRASFSSVGAELEVMAPGVSVYSTYP KAVSSGIVVAAAAGNEGSSGSTSTVGYPAKYPSTIAVGAVNSSNQRASFSSVGSELDVMAPGVSIQSTLP KAVSSGIVVAAAAGNEGSSGSTSTVGYPAKYPSTIAVGAVNSSNQRASFSSAGSELDVMAPGVSIQSTLP KAVSSGIVVAAAAGNEGSSGSSSTVGYPAKYPSTIAVGAVNSSNQRASFSSAGSELDVMAPGVSIQSTLP ... KAVSSGIVVAAAAGNEGSSGSSSTVGYPAKYPSTIAVGAVNSSNQRASFSSAGSELDVMAPGVSIQSTLP KAVSSGIVVAAAAGNEGSSGSSSTVGYPAKYPSTIAVGAVNSSVQRASFSSAGSELDVMAPGVSIQSTLP KAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLP ... AQSVPYGISQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLNVRGGASFVPSETNPYQDGSSHGPHVAG AQSVPYGISQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLNVRGGASFVPSETNPYQDGSSHGTHVAQ AQSVPYGVSQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAG...
Ngày tải lên: 21/02/2014, 03:20
Triennial Central Bank Survey: Foreign exchange and derivatives market activity in April 2010 pptx
... institutions with non-financial customers 155 87 56 11 58 56 36 331 219 98 14 68 66 30 62 1 3 25 241 55 61 52 39 1,210 55 2 57 4 85 72 46 47 1,2 75 537 58 5 154 61 42 46 12 Options and other products² with ... customers 2 65 150 89 27 100 56 34 10 Local 133 50 207 42 414 40 56 4 33 762 37 Cross-border 132 50 282 58 60 9 59 1,120 66 1,321 63 489 100 323 66 142 29 25 1,0 25 100 494 48 450 44 79 1 ,68 6 100 800 ... 13 743 1,1 85 1,274 2, 051 1,3 95 2 ,5 86 Local Cross-border 69 8 828 38 61 38 62 35 65 Outright forwards Up to days Over days and up to year Over year 128 100 65 51 57 45 130 100 51 39 76 58 209 100...
Ngày tải lên: 06/03/2014, 02:21
Báo cáo khoa học: Interference with the citrulline-based nitric oxide synthase assay by argininosuccinate lyase activity in Arabidopsis extracts docx
... Lett 5 76, 151 – 155 32 Planchet E, Jagadis Gupta K, Sonoda M & Kaiser WM (20 05) Nitric oxide emission from tobacco leaves and cell suspensions: rate limiting factors and evidence for the involvement ... Biochem J 357 , 59 3 61 5 Stuehr DJ, Santolini J, Wang ZQ, Wei CC & Adak S (2004) Update on mechanism and catalytic regulation in the NO synthases J Biol Chem 279, 361 67– 361 70 Li H & Poulos TL (20 05) Structure–function ... fumarate) is favored; reported Km values for argininosuccinate range from 0.13 mm in jack bean [52 ] to 0.2 mm in human liver [53 ], whereas the reported Km values for the reverse reaction are 5. 3 mm for...
Ngày tải lên: 07/03/2014, 05:20
Báo cáo khoa học: A new approach for distinguishing cathepsin E and D activity in antigen-processing organelles pdf
... EF + PepA 5 10 10 10 15 15 15 20 20 20 25 25 25 30 30 30 35 35 35 J Substrate + CF (IP) K Substrate + LF (IP) L Substrate + EF (IP) 5 10 10 10 15 15 15 20 20 25 25 30 30 35 35 Relative Fluorescence ... Substrate + CF 20 25. 54 E Substrate + LF 25 F Substrate + EF 5 10 Elution time (min) 25. 19 10 10 15 15 15 20 20 25 25 30 30 35 35 G Substrate + CF + PepA 20 22.87 25. 90 22.38 25. 44 25 30 35 H Substrate ... 0. 76 0. 76 ND 1 06. 3 25. 3 80.9 20.9 9 .5 11.3 210.7 23.2 187 .5 82.0 65 .4 16. 6 13.7 11.8 1.9 232.8 2 25. 7 7.1 WT100 DCs ± 2. 15 ± 2. 15 ± 0.19 ± 0.19 ± 0.24 ± 0.24 and the quencher group Figure 6B shows...
Ngày tải lên: 07/03/2014, 09:20
Can’t Shake that Feeling: Event-Related fMRI Assessment of Sustained Amygdala Activity in Response to Emotional Information in Depressed Individuals pptx
... 51 1a 62 4a 292 373 1 76 303 Ϫ.048 Ϫ .52 1a 52 0a 461 334 491 63 8b 60 2a 484 323 214 1 96 Ϫ.1 35 Ϫ .51 7a 53 5a 58 8a 57 2a 731b 67 8b 68 2b 742b 359 350 2 05 088 Ϫ. 469 fMRI, functional magnetic resonance imaging; ... 8, 61 19, 5, Ϫ12 Ϫ 15, Ϫ4, 6 Ϫ21, Ϫ10, Ϫ8 54 , Ϫ23, 32 4, Ϫ31, 18 p1 p p p p p p p Ͻ Ͻ Ͻ Ͻ Ͻ Ͻ Ͻ 01 05 05 1 p2 p p p p p p p Ͻ Ͻ Ͻ Ͻ Ͻ Ͻ Ͻ 05 05 05 01 05 05 05 Location Middle frontal gyrus BA 46 ... inhibition of valence units by decision units Number of negative stimuli representing depressogenic loss Value 65 (30 personally relevant, 30 nonpersonally relevant, numbers) 65 68 0.04 (via logistic)...
Ngày tải lên: 07/03/2014, 17:20
Báo cáo khoa học: Critical role of the plasma membrane for expression of mammalian mitochondrial side chain cleavage activity in yeast pptx
... 164 97– 1 65 02 63 Chudaev, M .V. , Gilep, A.A & Usanov, S.A (2001) Site-directed mutagenesis of cytochrome b5 for studies of its interaction with cytochrome P 450 Biochemistry (Mosc) 66 , 66 7 68 1 64 Thierry, ... Saccharomyces cerevisiae ERG27 gene encoding the 3-keto reductase involved in C-4 sterol demethylation Proc Natl Acad Sci USA 96, 1 2 65 5 1 266 0 Zinser, E., Sperka-Gottlieb, C.D., Fasch, E .V. , Kohlwein, ... FY 167 9/ pYeDP60, FY 167 9/pCD69 (expressing Tgl1p), CDS04/pCD69 (see above), and CDS04/pYeDP60 cells Data are mean values ± SEM from three independent experiments with a maximum deviation of 5% ...
Ngày tải lên: 08/03/2014, 08:20
Báo cáo Y học: Restoring enzyme activity in nonfunctional low erucic acid Brassica napus fatty acid elongase 1 by a single amino acid substitution pdf
... B r R500 B n Westar A t Col pYES2.1 16. 34 15. 77 15. 22 14.91 16. 12 19.22 43.27 44.84 43. 76 45. 50 40 .64 40 .67 3.97 3 .62 3. 96 4. 75 4 .69 5. 88 15. 15 13.90 14.97 29.03 18 .63 24 .69 1 .52 1. 56 1. 46 1.02 ... 1.02 1 .68 1.01 0. 45 0.49 0. 45 0.07 1 .67 0.00 0.99 1.10 0.94 0.00 3.17 0.00 2.07 2.19 1.94 0.00 0. 85 0.00 1. 25 1.07 1 .54 0.00 0.37 0.00 0. 15 0.17 0. 46 0.00 0.07 0.00 4.91 5. 02 5. 33 0.07 6. 13 0.00 ... Gal1 Forward primer (Invitrogen) and V5 Cterminus Reverse primer (Invitrogen), and primers VBE3 and VBE4 Yeast cells (line Inv Sc1, Invitrogen), were transformed with pYES2.1 /V5 -His-TOPO constructs...
Ngày tải lên: 08/03/2014, 09:20
Báo cáo khoa học: Catalytic mechanism of the primary human prostaglandin F2asynthase, aldo-keto reductase 1B1 – prostaglandin D2 synthase activity in the absence of NADP(H) pptx
... pH values were found to be pH 5. 0 for PGFS activity and pH 8 .5 for PGDS activity of AKR1B3 The pKb value of PGFS activity and the pKa value of PGDS activity were calculated by Eqn (1) to be 5. 39 ... activity of AKR1B1 N Nagata et al 151 nmolÆmin)1Æ(mg protein))1, respectively, for PGDS activity in the absence of NADPH or NADP+ at pH 8 .5 However, AKR1B3 showed a Km value of 33 lm and Vmax value ... activity at pH 5. 0, and 18 lm and 57 nmolÆmin)1Æ(mg protein))1, respectively, for PGDS activity at pH 8 .5 (Fig S1B) Similar affinities for the substrate PGH2 and Vmax values of PGFS and PGDS activities...
Ngày tải lên: 14/03/2014, 23:20