exercise 1 optimizing a method by caching data

Exercise 1 Developing a Security Plan

Exercise 1 Developing a Security Plan

... the HR database secure the information Partition the information available in the HR database so that information that can be accessed externally is in a different section of the database from ... data and how to save data to file servers Implement a disaster recovery plan and make sure that the backup strategy can recover at least all of the data from the previous day Make sure that permissions ... evidence of DoS attacks and attempted DoS attacks Regularly update the training plan and advise internal users of the changes Test the backup strategy and recovery plan regularly to ensure that it meets...

Ngày tải lên: 27/10/2013, 07:15

2 284 0
Periodic fibre suspension in a viscoelastic fluid   a simulation by a boundery element method 1

Periodic fibre suspension in a viscoelastic fluid a simulation by a boundery element method 1

... equations are applicable for the simulation of multiple fibres suspended in viscoelastic shear flow All simulated results are well compared to available experimental observations This indicates ... Governing equations and Formulation - 11 2 .1 Kinematics - 11 2 .1. 1 Velocity and Acceleration - 12 2 .1. 2 Velocity ... method GMRES Generalized Minimal Residual method MD Molecular Dynamics MPI Message Passing Interface PVM Parallel Virtual Machine SPH Smoothed Particle Hydrodynamics vii TABLE OF CONTENTS Introduction...

Ngày tải lên: 12/09/2015, 08:18

13 216 0
Tài liệu Activity 6.2: Optimizing a Physical Data Design pptx

Tài liệu Activity 6.2: Optimizing a Physical Data Design pptx

... to the main SQL Server database daily Create a separate database and table for the client computers that only accept timesheet data Replicate this data to the main database as needed Management ... situation has been identified as a performance problem by the database administrators, and they are requesting a fix as soon as possible (The field is already indexed.) Solutions can vary Denormalize ... 36 Activity 6.2: Optimizing a Physical Data Design Exercise 1: Determining Areas for Optimization In this exercise, you will evaluate the logical data design presented in the following illustration,...

Ngày tải lên: 17/01/2014, 09:20

4 324 0
Tài liệu Appendix A: Checklist 1 – Planning a Data Center Environment pdf

Tài liệu Appendix A: Checklist 1 – Planning a Data Center Environment pdf

... Performance monitoring System tuning Appendix A: Checklist – Planning a Data Center Environment Change Management Change management process Identify issue Justification for change Approval for change ... Appendix A: Checklist – Planning a Data Center Environment Physical Security Restrict access Physical facility Configuration information Administration tools Documentation Locks Doors Gated areas ... People Management, Operations, and Support Staff Organizational structure Find and retain highly skilled staff Training Communication channels Redundancy Microsoft Operations Framework team model...

Ngày tải lên: 24/01/2014, 10:20

4 301 0
Tài liệu Báo cáo khoa học: Kinetics of dextran-independent a-(1 fi 3)-glucan synthesis by Streptococcus sobrinus glucosyltransferase I pdf

Tài liệu Báo cáo khoa học: Kinetics of dextran-independent a-(1 fi 3)-glucan synthesis by Streptococcus sobrinus glucosyltransferase I pdf

... a- d-glucopyranoside was used as a glucose analog that is not a substrate of hexokinase in a glucose assay system The data were analyzed on the basis of the Michaelis–Menten equation; the maximum activity ... lactic acid bacteria Microbiol Mol Biol Rev 70, 15 7 17 6 Mooser G (19 92) Glycosidases and glycosyltransferases Enzymes 20, 18 7–2 31 Abo H, Matsumura T, Kodama T, Ohta H, Fukui K, Kato K & Kagawa ... kcat ⁄ Km (s )1 mM )1) 31 kcat (s )1) 0.56 2.0 2.2 4.6 41 41 69 65 59 40 ± ± ± ± 0.27 0.4 0.3 1. 2 11 ± ± ± ± ± ± ± Acc Km (mM) 25 12 19 78 12 33 17 13 ± ± ± ± ± ± Acc kcat ⁄ Km (s )1 mM )1) 65 10 ...

Ngày tải lên: 14/02/2014, 22:20

10 676 0
Báo cáo khoa học: "A Method for Relating Multiple Newspaper Articles by Using Graphs, and Its Application to Webcasting" pptx

Báo cáo khoa học: "A Method for Relating Multiple Newspaper Articles by Using Graphs, and Its Application to Webcasting" pptx

... 19 97 Multi-document Summarization by Graph Search and Matching Proe of AAAI'97, pages 622-628 Y M a a r e k and A Wecker 19 94 The Librarian Assistant: Automatically Assemblin Books into Dy- 13 13 ... et al., 19 95; Yamamoto et al., 19 95; Mani et al., 19 97) McKeown et al reported a method for summarizing news articles (McKeown et al., 19 95) In their approach, templates, which have slots and ... scatter/gather approach for facilitating information retrieval (Hearst et al., 19 95) Maarek et al related documents by using an hierarchical clustering algorithm that interacts with the user Although...

Ngày tải lên: 08/03/2014, 06:20

7 419 0
Báo cáo Y học: Mechanism of 1,4-dehydrogenation catalyzed by a fatty acid (1,4)-desaturase of Calendula officinalis pptx

Báo cáo Y học: Mechanism of 1,4-dehydrogenation catalyzed by a fatty acid (1,4)-desaturase of Calendula officinalis pptx

... 10 (E) ,12 (E)-tetradecadienoate by initial H-abstraction at C10 and 11 (E)-tetradecenoate to 9(Z) ,11 (E)-tetradecadienoate by initial oxidative attack at C9 [39] Whether these two transformations are catalyzed by separate ... [8,82H2] -1 Incubation experiments For characterization of the Calendula fatty acid conjugase, the yeast strain DTY10 -a2 (MATa, fas2D::LEU2, can 110 0, ura3 -1, ade2 -1, his3 -11 , his3 -15 ) [28] was transformed ... [8,82H2] -1 and [11 ,11 -2H2] -1 obtained via these procedures was 5% and 14 %, respectively Purification of substrates was carried out by flash chromatography (silica gel, 0.5% v/v ethyl acetate/hexane) and...

Ngày tải lên: 08/03/2014, 09:20

6 341 0
A Step-by-Step Guide to SPSS for Sport and Exercise Studies potx

A Step-by-Step Guide to SPSS for Sport and Exercise Studies potx

... Preface Acknowledgements Introduction xi xiii Data Entry Data handling File New Open Read Text Data Save As 13 Display Data Info 13 Apply Data Dictionary 13 Page Setup 15 Print Preview 16 Print 17 ... Correlate Bivariate 11 4 Correlate Partial 11 9 Regression/Linear 12 0 Classify/Discriminant 13 2 Data Reduction/Factor 13 8 Scale/Reliability Analysis 14 6 Nonparametric Tests/Chi-square 15 0 Nonparametric ... with an existing data file To save you the trouble of applying labels, missing values, and formats to these variables (see Data entry in 14 Data handling Dialog box 14 Table Data handling 15 Chapter...

Ngày tải lên: 24/03/2014, 02:20

268 432 0
Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf

Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf

... QLQRDALRHFAPCPPRARGLQEARVALEPALEPGFAARLQAQRICLERADAGPLGVAGS RAT R3E 11 9 QLQRDALRHFAPCPPRTRGLQDARIALEPALEPGFAARLQAQRICLERADAGPLGVAGS HUMAN R3E 11 9 QLQRDALRHFAPCQPRARGLQEARAALEPASEPGFAARLLTQRICLERAEAGPLGVAGS PP1 binding ... TGA gacgaggcgcctgcggccgacggcggaaaacaccaaaggcacccgggggcggggcgacccgatgtggcggggaggagtag 920 I H F I * 279 9 21 gagagaccaggattggcgggagcggtccaagggagtc 957 Fig (A) Diagram of human PPP1R3E mRNA compared ... ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPSPPRADRFAFRLPAPPVGGTLLF RAT R3E 17 8 ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPAPPRADRFAFRLPAPPVGGALLF HUMAN R3E 17 8 ARVVDLAYEKRVSVRWSADGWRSQREAPAAYAGPAPPPPRADRFAFRLPAPPIGGALLF GM/ RGL/R3A...

Ngày tải lên: 30/03/2014, 16:20

12 381 0
Báo cáo hóa học: " Evidence that the Nijmegen breakage syndrome protein, an early sensor of double-strand DNA breaks (DSB), is involved in HIV-1 post-integration repair by recruiting the ataxia telangiectasia-mutated kinase in a " pptx

Báo cáo hóa học: " Evidence that the Nijmegen breakage syndrome protein, an early sensor of double-strand DNA breaks (DSB), is involved in HIV-1 post-integration repair by recruiting the ataxia telangiectasia-mutated kinase in a " pptx

... 12 :18 46 -18 51 Tauchi H, Kobayashi J, Morishima K, Matsuura S, Nakamura A, Shiraishi T, Ito E, Masnada D, Delia D, Komatsu K: The forkhead-associated domain of NBS1 is essential for nuclear foci formation ... DNA duplexes and may function as an anchor to hold the DNA ends together at a DSB [11 ]; and NBS1 itself NBS1 associates with DSBs immediately after the DNA damage occurs [12 ] and recruits MRE 11 ... Sakamoto S, Nakamura A, Morishima K, Matsuura S, Kobayashi T, Tamai K, Tanimoto K, Komatsu K: NBS1 localizes to gamma-H2AX foci through interaction with the FHA/BRCT domain Curr Biol 2002, 12 :18 46 -18 51...

Ngày tải lên: 20/06/2014, 01:20

12 398 0
Báo cáo hóa học: " Research Article A New Inverse Halftoning Method Using Reversible Data Hiding for Halftone Images" docx

Báo cáo hóa học: " Research Article A New Inverse Halftoning Method Using Reversible Data Hiding for Halftone Images" docx

... 15 1 18 1 211 2 41 2 71 3 01 3 31 3 61 3 91 4 21 4 51 4 81 511 12 00 10 00 800 600 400 200 Figure 12 : The pattern histogram of halftone image Lena Apply the LIH procedure to an input halftone image H, and ... Stego halftone image Embedding operation Extracting operation (a) 0 1 1 0 1 0 0 0 0 1 1 0 1 0 Embed “0 1 1 0 1 0 1 0 1 1 0 1 1 0 (b) Figure 3: The embedding and extracting diagram and an example ... never appear in an image EURASIP Journal on Advances in Signal Processing 1 1 1 0 0 Predicted by LUT Halftone image Original grayscale image 0 Halftoning predicted by Gaussian filtering 17 0 15 16 0...

Ngày tải lên: 21/06/2014, 08:20

13 329 0
Báo cáo y học: "Quantitative gait analysis as a method to assess mechanical hyperalgesia modulated by disease-modifying antirheumatoid drugs in the adjuvant-induced arthritic rat" pps

Báo cáo y học: "Quantitative gait analysis as a method to assess mechanical hyperalgesia modulated by disease-modifying antirheumatoid drugs in the adjuvant-induced arthritic rat" pps

... adjuvant arthritic rats Clin Exp Rheumatol 19 99, 17 :553-560 40 Segawa Y, Yamaura M, Aota S, Omata T, Tuzuike N, Itokazu Y, Oka H, Tamaki H, Nakamura T: Methotrexate maintains bone mass by preventing ... Murihead KA, Hanna N: Methotrexate inhibits macrophage activation as well as vascular and cellular inflammatory events in rat adjuvant induced arthritis J Rheumatol 19 88, 15 :745-749 47 Davis P, ... Chicago, IL, USA) was used to analyze the data Throughout the study, the mean ± standard error of means was used to describe the data in the figures The data were analyzed using two-way analysis...

Ngày tải lên: 09/08/2014, 10:21

7 569 0
Báo cáo y học: " A method for studying decision-making by guideline development groups" potx

Báo cáo y học: " A method for studying decision-making by guideline development groups" potx

... systematically reducing data via application of a coding frame, developed from a broad thematic analysis of a subset of data, to extract data excerpts warranting further analysis Identifying areas of interest ... stages 2a and 2b: the relevance of available theories and evidence is evaluated at stage 3a prior to application of these to the data excerpts identified at stage 2b In this way, data extraction ... textual data to allow us to address the research questions of the EiR study [10 ] More finegrained analyses may be possible where non-verbal data is available, for example via transcription of audio...

Ngày tải lên: 11/08/2014, 05:21

9 408 0
báo cáo khoa học: " Classification of unknown primary tumors with a data-driven method based on a large microarray reference database" ppsx

báo cáo khoa học: " Classification of unknown primary tumors with a data-driven method based on a large microarray reference database" ppsx

... SLCO4C1 GALNT14 SLC2 2A2 TMCC1 PLVAP SLC2 8A1 PHKA2 ATAD2 SLC1 3A1 DOC 2A CYP2J2 SLC2 2A 11 BBOX1 EGLN3 TLR3 SLC1 7A1 10 Lung metastasis 0.5 Lung metastasis Intestinal metastasis Lung metastasis 10 Lung ... 99% 98% Pancreatic cancer 13 30.8% 23% 99% Prostate cancer 10 11 90.9% 91% 10 0% 10 0% Renal cancer 10 11 90.9% 91% Sarcoma 71. 4% 71% 97% Testicular cancer 13 16 81. 3% 81% 10 0% Thyroid cancer 66.7% ... Kaneko N, Suganuma K, Watanabe M, Matsubara T, Seto R, Matsumoto J, Kawakami M, Yamamori M, Nakamura T, Yagami T, Sakaeda T, Fujisawa M, Nishimura O, Okumura K: Quantitative proteomic analysis to...

Ngày tải lên: 11/08/2014, 12:21

12 391 0
báo cáo khoa học: " A method for studying decision-making by guideline development groups" docx

báo cáo khoa học: " A method for studying decision-making by guideline development groups" docx

... systematically reducing data via application of a coding frame, developed from a broad thematic analysis of a subset of data, to extract data excerpts warranting further analysis Identifying areas of interest ... stages 2a and 2b: the relevance of available theories and evidence is evaluated at stage 3a prior to application of these to the data excerpts identified at stage 2b In this way, data extraction ... textual data to allow us to address the research questions of the EiR study [10 ] More finegrained analyses may be possible where non-verbal data is available, for example via transcription of audio...

Ngày tải lên: 11/08/2014, 16:20

9 243 0
Báo cáo khoa học: "Clinical significance of 4 patients with chronic hepatitis B achieving HBsAg clearance by treated with pegylated interferon alpha-2a for less than 1 year: a short report" pot

Báo cáo khoa học: "Clinical significance of 4 patients with chronic hepatitis B achieving HBsAg clearance by treated with pegylated interferon alpha-2a for less than 1 year: a short report" pot

... sequential therapy with pegasys and entecavir(Baraclude) Pegasys was administered at a dose of 18 0 ug intracutaneously one time per week Baraclude was administered at a dose of 0.5 mg orally one ... help eradicate HBV infectious hepatocytes by dual anti-viral and immunomodulatory mode of action [10 ] In contrast to nucleoside analogues, pegylated interferon alpha- 2a has a higher rate of HBeAg ... months Among them, serum HBV DNA was arrayed by fluorescent quantitative PCR and HBV markers were arrayed by ELISA Results Therapeutic efficacy Within less than year, serum HBV DNA loss, ALT normalization,...

Ngày tải lên: 12/08/2014, 04:21

3 328 0
w