erk1 2 by g s

Báo cáo khoa học: Sustained activation of ERK1/2 by NGF induces microRNA-221 and 222 in PC12 cells pdf

Báo cáo khoa học: Sustained activation of ERK1/2 by NGF induces microRNA-221 and 222 in PC12 cells pdf

Ngày tải lên : 16/03/2014, 01:20
... through AP-1 signaling [26 ] AP-1 family proteins are good candidates for mediating NGF-induced miR -22 1 ⁄ 22 2 expression in PC 12 cells A previous study showed that miR -22 1 and 22 2 are up-regulated ... miR -22 1 or miR -22 2 resulted in significant (P < 0.05) FEBS Journal 27 6 (20 09) 326 9– 327 6 ª 20 09 The Authors Journal compilation ª 20 09 FEBS K Terasawa et al NGF induces miR -22 1 and 22 2 expression ... 20 09 FEBS 327 1 NGF induces miR -22 1 and 22 2 expression K Terasawa et al A B C Fig Sustained activation of ERK1 ⁄ is required for NGF-induced miR -22 1 ⁄ 22 2 expression (A) Schematic diagram of the...
  • 8
  • 334
  • 0
báo cáo hóa học:" Activation of PKA, p38 MAPK and ERK1/2 by gonadotropins in cumulus cells is critical for induction of EGF-like factor and TACE/ ADAM17 gene expression during in vitro maturation of porcine COCs" doc

báo cáo hóa học:" Activation of PKA, p38 MAPK and ERK1/2 by gonadotropins in cumulus cells is critical for induction of EGF-like factor and TACE/ ADAM17 gene expression during in vitro maturation of porcine COCs" doc

Ngày tải lên : 20/06/2014, 07:20
... CAG AAA-3' 5'-GAC ATG AAT GGC AAA TGT GAG AAA C-3' 5'-AGT CTG TGC TGG GGT CTT CCT GGA-3' 5'-GAA TTA CCC AGT CCT GGC TT-3' 5'-TCA TAA CTC CAT ATG GCT TGA AC-3' 5'-CTG CCG TGT CGC TCT GCA CTG-3' ... TGA GCT GCG TGT GG-3' 5'-TAG CTC TTC TCC AGG GAG GA-3' 5'-CAC CAG AAC AAA AAG GTT CTG TC-3' 5'-AAG TCC ATG AAG ACT CAC ACC AT-3' 5'AAG ACA ATC CAC GTG TGG CTC AAG-3' 5'-CGA TTT TTG TAC CAT CTG ... COCs In granulosa cell specific Erk1/ 2 knockout mice, the cumulus expansion was completely suppressed via the low induction of Ptgs2 expression In this study, the Ptgs2 expression level was suppressed...
  • 9
  • 388
  • 0
Báo cáo khoa học: Identification of sites of phosphorylation by G-protein-coupled receptor kinase 2 in b-tubulin ppt

Báo cáo khoa học: Identification of sites of phosphorylation by G-protein-coupled receptor kinase 2 in b-tubulin ppt

Ngày tải lên : 17/03/2014, 09:20
... EQSGYHVEQEKENKLLCEDLPGTEDFVGHQGTVPSDNIDSQGRNCSTNDSLL-OH EPAPAGPRDTDALDLEESSSSDHAERPPGPRRPERGPRGKGKARA EEKESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSK KSWKPSAEQMDQDHSSSDSWNNNDAAASLENSASSDEEDIGSETR ... These results suggest that GRK2 is the kinase that phosphorylates Ser444, although we cannot exclude the involvement of other kinases such as casein kinase II [35] This assumption is supported by ... of G- protein bc subunits [14] All these peptides with GRK2-stimulating activity, including mastoparan, are basic peptides Recent studies have suggested that GRK may phosphorylate substrates other...
  • 10
  • 267
  • 0
Báo cáo y học: "All-trans retinoic acid suppresses interleukin-6 expression in interleukin-1-stimulated synovial fibroblasts by inhibition of ERK1/2 pathway independently of RAR activation" ppsx

Báo cáo y học: "All-trans retinoic acid suppresses interleukin-6 expression in interleukin-1-stimulated synovial fibroblasts by inhibition of ERK1/2 pathway independently of RAR activation" ppsx

Ngày tải lên : 09/08/2014, 01:22
... RXR-β (sense: 5'-CTTCATGTGCACAGAAACT-3', anti-sense: 5'-TCTGTCAGCACCCGATCAAA-3', NM 20 6849, 68 bp, 55°C), RXR-γ (sense: 5'-CTGCACCGGGCAGGGTGGAAT-3', anti-sense: 5'-CTGGACGGAAACCGAGCGGTG-3', NM ... sequences of the primers used were IL-6 (sense: 5'-CCGGAGAGGAGACTTCACAG-3', anti-sense: 5'-CCGGAGAGGAGACTTCACAG-3', NM 0 125 89, 161 base pairs [bp], 59°C), RARα (sense: 5'-ACCAGATTACCCTTCTCAAGG-3', ... (sense: 5'-AGTGCTATCTGCCTCATCT-3', anti-sense: 5'-TTGTCCACCTTCACCTTCTCGGGTTC-3', NM 0010 624 12, 66 bp, 62 C), RXR-α (5': GAAGCGTACTGCAAACACAAG-3', anti-sense: 5'CAGCCGGAGCAGCAGCTTGG-3', NM 0 128 05, 65...
  • 12
  • 386
  • 0
báo cáo khoa học: " Statin-induced apoptosis via the suppression of ERK1/2 and Akt activation by inhibition of the geranylgeranyl-pyrophosphate biosynthesis in glioblastoma" potx

báo cáo khoa học: " Statin-induced apoptosis via the suppression of ERK1/2 and Akt activation by inhibition of the geranylgeranyl-pyrophosphate biosynthesis in glioblastoma" potx

Ngày tải lên : 10/08/2014, 10:21
... of GGPP biosynthesis [10,11] These findings suggest that statins induce apoptosis by activation of caspase-3 through suppression of GGPP biosynthesis GGPP is an important membrane-anchoring molecule ... also found that statins induce apoptosis by activation of caspase-3 through inhibition of GGPP biosynthesis It has been reported that statins inhibit prenylation of small G proteins by suppressing ... purchased from Sigma These reagents were dissolved in DMSO These dissolved reagents were then resuspended in PBS (0.05 M; pH 7.4) and filtered through syringe filters (0.45 μm; Iwaki Glass) before...
  • 8
  • 236
  • 0
Tư liệu quý - Địa danh Việt Nam (phần 2: D-G)

Tư liệu quý - Địa danh Việt Nam (phần 2: D-G)

Ngày tải lên : 20/07/2013, 01:25
... 1354,0 621 ,3 Dân s (Nghìn người) 186,6 139,0 150 ,2 100,6 100,7 94,9 55,1 35,9 29 ,7 22 ,1 34 ,2 58,4 74,4 37,9 20 ,2 59,5 66,6 Mật độ (Người/Km2) 7 02 2 12 237 121 153 93 43 32 29 10 19 52 88 26 11 ... thuộc hệ thống s ng Đồng Nai, bắt nguồn từ núi Hòn Giao phía ĐB tỉnh Lâm Đồng, chảy vào hồ Đơn Dương, sau vào s ng Đắc Dung (đoạn thượng nguồn s ng Đồng Nai) Trên s ng có hệ thống ống dẫn nước ... 9 62, 9 781,3 Dân s (Nghìn người) 416,5 90 ,2 297,9 173,7 105,9 20 3 ,2 2 82, 3 197,3 154,7 Mật độ (Người/Km2) 26 92 84 588 325 25 9 408 29 8 20 4 198 Huyện phía N tỉnh Bình Phước, giáp tỉnh Bình Dương...
  • 19
  • 722
  • 5
Toán 7 : Trường hợp bằng nhau thứ 2 ( c.g.c)

Toán 7 : Trường hợp bằng nhau thứ 2 ( c.g.c)

Ngày tải lên : 09/10/2013, 12:11
... ∆IKG Vì : GH = KI · · HGK = IKG GK cạnh chung \ Q Hình 84 Không có tam giác P * Về nhà học thật kỹ tính chất hệ * Làm tập 24 , 26 trang 118 sgk , 27 , 28 , 29 trang 119, 120 sgk ... vuông tam giác vuông hai tam giác vuông hai cạnh g c xen hai cạnh g c nhọn hai cạnh g c vuông Củng cố Bài tập 25 / 118 sgk : Trên hình 82 , 83, 84 có tam giác ? Vì ? G A \1 B / D Hình 82 N H ... vuông Củng cố Điền từ thích hợp vào chỗ trống câu sau để khẳng định Nếu hai cạnh g c xen tam giác hai cạnh g c xen hai tam giác hai tam giác 2. Nếu hai cạnh g c vuông tam giác vuông hai cạnh g c...
  • 12
  • 568
  • 0
Microsoft ASP .NET Step by Step by G. Andrew Duthie

Microsoft ASP .NET Step by Step by G. Andrew Duthie

Ngày tải lên : 26/10/2013, 22:15
... System.Int 32 byte s * uint System.UInt 32 † byte s Long long System.Int64 byte s * ulong System.UInt64 † byte s Object object System.Object byte s Short short System.Int16 byte s * ushort System.UInt16 byte ... string parameters, concatenates them, and then returns the result to the caller as a string: Function ConcatStrings(ByVal String1 As String, _ ByVal String2 As String) As String ConcatStrings ... needed by most large businesses, right out of the box This section will discuss these products and their features SQL Server 20 00 SQL Server 20 00 is Microsoft s enterprise-class database management...
  • 391
  • 913
  • 0
An analysis of the inaugural address by g w bush in the u s president election 2004 from a perspective of discoure analysis

An analysis of the inaugural address by g w bush in the u s president election 2004 from a perspective of discoure analysis

Ngày tải lên : 18/12/2013, 10:08
... findings answer the research questions Part 3: Conclusion summarizes the findings of the study, giving concluding remarks, implications, limitations of the study and suggestions for further studies ... Channel shows the choice of speech, writing, signing, etc (6) Code is what language or dialect, or style of language is being used (7) Message-form gives the style of the intended form of the message ... Edinburgh: Edinburgh University Press Gumperz, J J (19 82) , Discourse strategies, Cambridge: CUP Nguyen Thi Huyen Le Vinh Uni 35 AN ANALYSIS OF THE INAUGURAL ADDRESS BY G. W BUSH IN THE U .S PRESIDENTIAL...
  • 44
  • 578
  • 0
Tài liệu Báo cáo khoa học: Synergistic activation of signalling to extracellular signal-regulated kinases 1 and 2 by epidermal growth factor and 4b-phorbol 12-myristate 13-acetate pptx

Tài liệu Báo cáo khoa học: Synergistic activation of signalling to extracellular signal-regulated kinases 1 and 2 by epidermal growth factor and 4b-phorbol 12-myristate 13-acetate pptx

Ngày tải lên : 19/02/2014, 16:20
... a site where the two signal inputs converge, for instance at Raf PKC phosphorylates Raf at Ser499, which was suggested to cause Ser259 autophosphorylation and activation [24 ] Ser259 was also ... both stimulators showed a considerably higher signal intensity (Fig 4B), which is consistent with the results discussed in the previous section Positive feedback circuit via cPLA2 and PKC is not ... about 12 min) before increasing slightly again This second increase was followed by a decrease to a relatively low level, after about h of EGF stimulation This ERK-PP profile suggests the possibility...
  • 9
  • 541
  • 0
Báo cáo khoa học: Activation of activating transcription factor 2 by p38 MAP kinase during apoptosis induced by human amylin in cultured pancreatic b-cells ppt

Báo cáo khoa học: Activation of activating transcription factor 2 by p38 MAP kinase during apoptosis induced by human amylin in cultured pancreatic b-cells ppt

Ngày tải lên : 07/03/2014, 12:20
... experiments, unlabelled oligonucleotides, either specific (containing the CRE sequence), or nonspecific [containing the SP1 binding site (5¢-AT TCGATCGGGGCGGGGCGAGC-3¢) in 20 0-fold excess], were ... pancreatic islet beta-cells J Mol Biol 324 , 27 1 28 5 16 Zhang SP, Liu JX, Saafi EL & Cooper GJS (1999) Induction of apoptosis by human amylin in RINm5F 3790 17 18 19 20 21 22 23 24 25 26 27 28 29 islet ... malignant insulinoma [45] CM cells express genes typical of the islet b-cell lineage, such as insulin and certain of the GLUT genes, respond to glucose stimulation and posses a functional glucose-signaling...
  • 13
  • 400
  • 0
Báo cáo Y học: Regulation of RAS in human platelets Evidence that activation of RAS is not sufficient to lead to ERK1-2 phosphorylation pot

Báo cáo Y học: Regulation of RAS in human platelets Evidence that activation of RAS is not sufficient to lead to ERK1-2 phosphorylation pot

Ngày tải lên : 08/03/2014, 16:20
... analysed by Western blotting using an anti-RAS Ig (top) Proteins of whole cell lysate were resolved by 12. 5% SDS/PAGE and analysed by Western blotting using anti-RAS Ig (bottom) Results presented ... blotting using an anti-RAS Ig (top) Proteins of whole cell lysate were resolved by 12. 5% SDS/PAGE and analysed by Western blotting using anti-RAS Ig (bottom) Results presented are representative ... 10% SDS/PAGE and analysed by Western blotting using an anti-phosphotyrosine Ig (top) The filter was stripped and reprobed using a monoclonal anti-GRB2 Ig (bottom) Results presented are representative...
  • 7
  • 436
  • 0
Thiết kế tuyến đường qua 2 điểm G-H thuộc địa phận huyện Krông Đắc tỉnh Đắc Lắc

Thiết kế tuyến đường qua 2 điểm G-H thuộc địa phận huyện Krông Đắc tỉnh Đắc Lắc

Ngày tải lên : 15/03/2014, 10:09
... 25 8.91 27 0. 92 281.68 29 1.05 28 3.80 28 2.45 26 9.75 26 5.17 26 5.71 26 4.57 25 8.10 26 0.15 27 1. 02 2 82. 80 29 1. 52 283.85 28 3.05 26 9.86 26 6.35 26 6 .20 26 5.35 25 8 .25 26 0.15 27 1. 02 2 82. 80 29 1. 52 283.85 28 3.05 26 9.86 ... 0. 92 0. 52 0.53 1.05 0.90 1.04 2. 02 1.06 1. 82 1.07 1.04 1.84 1.81 2. 03 H2 H3 Hnmin 25 9.81 27 3.65 28 1.61 28 7. 12 275.95 26 2.85 26 5.43 25 8.08 25 9.95 27 3.80 28 2.14 28 7 .20 27 6 .20 26 3.50 26 6.00 25 9 .25 ... 1 .25 Ko áp 1 .25 Ko áp 1.5 Cao độ khống chế Cao độ H1 đáy cống 25 7.41 25 8.51 26 9 .25 27 0.85 27 9.93 28 0.83 29 0.06 29 0.98 28 1.54 28 3.70 28 0.70 28 1.57 26 8.36 26 9.69 26 3. 92 264.83 26 3.96 26 4.84 26 2.82...
  • 118
  • 437
  • 0
Báo cáo khoa học: Membrane type-1 matrix metalloprotease-independent activation of pro-matrix metalloprotease-2 by proprotein convertases docx

Báo cáo khoa học: Membrane type-1 matrix metalloprotease-independent activation of pro-matrix metalloprotease-2 by proprotein convertases docx

Ngày tải lên : 16/03/2014, 00:20
... encoding site in italics) and the reverse primer 5¢-GCCACATC TGGGTTGCCGCACTTGTCGTCATCGTCTTTGTAGTC GCGTGGCTTCCGCATGGTCT-3¢ (FLAG encoding site in italics) Site-directed mutagenesis was performed toprepare ... cell surface via these molecules, which may promote intermolecular autolytic cleavage of PC-processed MMP -2 CATGCGGAAGCCACGCGACTACAAAGACGATGACG ACAAGTGCGGCAACCCAGATGTGGC-3¢ (FLAG encoding site ... NM_004530) Oligonucleotide primers 5¢-GCTACGATG GAGGCGCTAATG GCC-3¢ (start codon in italics) and 5¢-TCAGCAGCCTAGC CAGTCGGATTTG-3¢ (stop codon in italics) were used for PCR with Advantage polymerase (Clontech)...
  • 14
  • 363
  • 0
Orders Of Infinity By G. H. Hardy pptx

Orders Of Infinity By G. H. Hardy pptx

Ngày tải lên : 16/03/2014, 15:20
... Cf Messenger of Mathematics, vol 31, p See Borel, Le¸ons sur les fonctions enti`res, pp 120 et seq.; Le¸ons sur les c e c s ries ` termes positifs, pp 32 et seq Borel considers the cases only ... small point that has sometimes been overlooked (see, e .g. , Borel, Le¸ons sur la th´orie des c e fonctions, p 114; Le¸ons sur les s ries ` termes positifs, p 26 ) It is not c e a always the case ... Mathematics, vol 14, p 21 4 Le¸ons sur les s ries ` termes positifs, p 27 c e a SCALES OF INFINITY IN GENERAL 15 So far we have confined our attention to ascending scales, such as x, x2 , x3 , ...
  • 101
  • 332
  • 0
Báo cáo khoa học: ERK and cell death: ERK1⁄2 in neuronal death Srinivasa Subramaniam1 and Klaus Unsicker2 pptx

Báo cáo khoa học: ERK and cell death: ERK1⁄2 in neuronal death Srinivasa Subramaniam1 and Klaus Unsicker2 pptx

Ngày tải lên : 29/03/2014, 08:20
... 26 563 26 571 32 Terasawa K, Ichimura A, Sato F, Shimizu K & Tsujimoto G (20 09) Sustained activation of ERK1by NGF induces microRNA -22 1 and 22 2 in PC 12 cells FEBS J 27 6, 326 9– 327 6 33 Stanciu M ... expression profile is not completely understood Sustained ERK1 ⁄ was shown to translocate to the nuclei, suggesting it may regulate prodeath gene expression [33,34] When sustained ERK1 ⁄ is retained ... pathway J Neurosci 25 , 28 38 28 52 26 Subramaniam S, Strelau J & Unsicker K (20 08) GDNF prevents TGF-beta-induced damage of the plasma membrane in cerebellar granule neurons by suppressing activation...
  • 8
  • 311
  • 0
Báo cáo khoa học: Oxidative neuronal injury The dark side of ERK1/2 potx

Báo cáo khoa học: Oxidative neuronal injury The dark side of ERK1/2 potx

Ngày tải lên : 30/03/2014, 13:20
... autophagolysosome systems have been implicated in neurodegenerative diseases [50,51] In degenerating neurons, phosphorylated ERK1/ 2 is observed in autophagocytosed mitochondria [ 52] Moreover, ERK1/ 2 ... with glutathione (reviewed in [56]) Progression to irreversible sulfinic acid (Cys-SO2H) or sulfonic acid (Cys-SO3H) forms may underlie pathologically sustained ERK1/ 2 responses Although redox regulation ... cytoplasm (e .g MKP3) or to the nucleus (e .g MKP1) Transfection studies with mutated MKPs suggest that inactivated phosphatases can serve as passive anchors for ERK1/ 2 (reviewed in [49]) Such a...
  • 7
  • 359
  • 0
Báo cáo khoa học: PKA independent and cell type specific activation of the expression of caudal homeobox gene Cdx-2 by cyclic AM pptx

Báo cáo khoa học: PKA independent and cell type specific activation of the expression of caudal homeobox gene Cdx-2 by cyclic AM pptx

Ngày tải lên : 30/03/2014, 16:20
... AACGACCCCTTCATTGAC TGCACCACCAACTGCTTAG GCCATTCACAGGGCACATTC CCTCCTGATGGTGATGTATCGA TAACCACCGTAGTCCGGGTACT AGCGACTGTAGTGAAACTCCTTCTC AGCATCACCCATTTGATGT TCCACGACATACTCAGCAC GACGCAGGGATGATGTTC CCGGTTCCTCTTGGTGTTCA ... Reverse primer Rat Cdx -2 Mouse Cdx -2 Human CDX2 Rat GAPDH Mouse GAPDH Human GAPDH Rat proglucagon AAACCAGGACGAAAGACAAATACC GGACGTGAGCATGTATCCTAGCT CCTCGGCAGCCAAGTGAA TGATTCTACCCACGGCAAGT AACGACCCCTTCATTGAC ... F/I V 20 20 20 20 20 Time (h) 24 24 C InR1 -G9 GLUTag C 0.4 C 8 24 C Time (h) 24 C 2 12 12 Cdx -2 Cdx -2 Tub D 3.1 Time (h) Tub 2. 9 1.4 2. 7 2. 6 3.7 4.3 Caco -2 C C 2 4 6 12 12 24 24 Time (h) Cdx -2 Tub...
  • 14
  • 506
  • 0

Xem thêm