... addition to the traditional array of print and broadcast sources, for dissemination of news and information. Every organization should have a program to stay in touch regularly with appropriate ... In addition to an ongoing public relations campaign it may be necessary to reach out to head off any negative publicity caused by lack of accurate information. Examples of appropriate use of ... transparencies. Press packages may include black-and-white photos and state that color material also is available via your Web site’s press section. Audio Tapes for Radio Audio tapes are rarely used, but can...
Ngày tải lên: 23/12/2013, 00:15
... effectiveness of a PR campaign? Find out at How to Plan a PR Campaign. How to Plan a PR Campaign is an intensive two-day seminar designed to show communications professionals how to plan, implement and ... should a really top notch PR plan contain? What do the professionals include? This session takes you thr ough all the critical stages of planning a PR campaign: ã The essential stages of planning a ... W rite a PR Plan What should a PR plan look like? What should it say? This session explains the practicalities of sitting down and writing a full-blown PR campaign: ã How to write a PR plan a step-by-step...
Ngày tải lên: 23/12/2013, 00:15
Tài liệu stanislaus von moos le corbusier elements of a synthesis docx
...
Ngày tải lên: 21/02/2014, 09:20
Family Life, Reproductive Health, and Population Education: Key Elements of a Health-Promoting School docx
Ngày tải lên: 22/03/2014, 12:20
Báo cáo khoa học: "The micronucleus frequency in cytokinesis-blocked lymphocytes of cattle in the vicinity of a nuclear power plant" ppt
Ngày tải lên: 07/08/2014, 20:23
Báo cáo y học: "A Comparative Effectiveness Study of Bone Density Changes in Women Over 40 Following Three Bone Health Plans Containing Variations of the Same Novel Plant-sourced Calcium"
... Kaats GR was the principal investigator; he se- cured and audited all study data, conducted all of the statistical analyses, and contributed significantly to the preparation and submission of ... following all three plans had an increase in MAPC: Plan 1=1.30%, Plan 2=2.00%, and Plan 3=4.1%. Using a repeat- ed-measures t-test, the MAPC from baseline in all three Plans was significant (P=0.003, ... Subjects in all three plans had an increase in MAPC: Plan 1=1.20%, Plan 2=0.33%, and Plan 3=2.5%. Using a repeated measures t-test, MAPC in Plan 1 and 3 were significant (P=0.027 and P=0.002...
Ngày tải lên: 25/10/2012, 11:10
Potential biogas production from sewage sludge: A case study of the sewage treatment plant at Kwame Nkrumah university of science and technology, Ghana
Ngày tải lên: 05/09/2013, 16:11
A LIST OF SOME PR FUNCTIONS
... advance for management of the crisis and the primary goal of this strategy should be the protection of participants, spectators and participating institutions. Having a strategy set in advance ... organizations and interest groups are "battling" for space or airtime. Press Releases Press releases help inform media of team-related news and events and can serve as a summary prior ... enter the data in and analyze if you have access to SPSS. If you do not have access to SPSS, the data can also be converted to other data analysis programs by your campus research department....
Ngày tải lên: 17/10/2013, 12:15
Tài liệu Advertising and PR campaign of Mobifone docx
... services providers seem to competed by value added services Advertising and PR campaign Advertising and PR campaign Media Media For For MCA service and MCA service and MobiFone MobiFone WEAKNESSES ... Its automatically. Media Ads PR Creative Marketing Strategy Creative Creative For For MCA service and MCA service and MobiFone MobiFone MARKETING Strategies: ִUndertake TET promotion program: ... Strategy Marketing Strategy For For MCA service and MCA service and MobiFone MobiFone PR campaign PR campaign For For MCA service and MCA service and MobiFone MobiFone STRENGTHS One of the...
Ngày tải lên: 21/01/2014, 03:20
Tài liệu Báo cáo khoa học: C-Terminal extension of a plant cysteine protease modulates proteolytic activity through a partial inhibitory mechanism doc
... aa 208 aa 24 aa BamH 34 aa Start Stop Xho1 N -Pro Protease domain Protease domain CT - ex 380 aa 1 II NP 114 aa 208 aa BamH1 34 aa Start Stop Xho1 SS SS G SSS S N-Pro 356 aa III MSTLFII S ILLFLAS F SYAMDI S TIEYKYDKSS AWRTDEEVKEIYELWLAKHDKVY SG LVEYEKRFEIFKDNLKFIDEH NSENHTYKMGLTPYTDLTNEEFQAIYLGTRSDTIHRLKRTINISERYAYEAGDNLPEQIDWRKKGAVTPVKNQGKCG SCWAFSTVSTVESINQIRTGNLISLSEQQLVDCNKKNHG CKGGAFVYAYQYIIDNGGIDTEANYPYKAVQGPCRAAK KVVRIDGYKGVPHCNENALKKAVASQPSVVAIDASSKQF QHYKSGIFSGPCGTKLNHGVVIVGYWKDYWIVRNSW GRYWGEQGYIRMKRVGGCGLCGIARLPYYPTKA AGDENSKLETPELLQWSEEAFPLA IV A B 66 ... rmErv-C +CT . Because Erv-C isolated from the latex of the same plant does not show the CT-extension, the possibility 19 aa 114 aa 208 aa 24 aa Pre N-Pro Protease domain CT - ex 365 aa H1 I N Pro CT ex 114 aa 208 ... Nakamura K & Matsuoka K (1993) Protein targeting to the vacuole in plant cells. Plant Physiol 101, 1–5. 10 Okamoto T, Yuki A, Mitsuhashi N & Mimamikawa T (1999) Asparaginyl endopeptidase...
Ngày tải lên: 14/02/2014, 14:20
Tài liệu Báo cáo khoa học: Crystal structure of Klebsiella sp. ASR1 phytase suggests substrate binding to a preformed active site that meets the requirements of a plant rhizosphere enzyme doc
... QuikChange site-directed mutagenesis kit (Stratagene, La Jolla, CA, USA). Plasmid pET-1TK was used as template and Kleb(HtoA)fw (5Â-GCTTAGCCGCGCCGGCATTCG) and Kleb(HtoA)rv (5Â-CGAATGCCGGCGCGGCTAAGC) ... groups of HAPs are adapted to different habitats. To support plant growth, bacteria do not need to release phosphate as fast as the diges- tive tract of an animal host, where possible substrates might ... similarity, the overall structure of Klebsiella phytase bears similar- ity to other histidine-acid phosphatases, such as E. coli phytase, glucose- 1-phosphatase and human prostatic-acid phosphatase....
Ngày tải lên: 16/02/2014, 09:20
Tài liệu THE ELEMENTS OF BACTERIOLOGICAL TECHNIQUE A LABORATORY GUIDE FOR MEDICAL, DENTAL, AND TECHNICAL STUDENTS pptx
... at the far corner of the table top is invaluable in the preparation of tubular apparatus with sharp curves, and for coating newly-made glass apparatus with a layer of soot to prevent too rapid ... how to fit up and adapt apparatus for his daily work, and how to carry out thoroughly and systematically the various bacterioscopical analyses that are daily demanded of the bacteriologist ... been prepared especially for this volume; for a picture, if good, possesses a higher educational value and conveys a more accurate impression than a page of print; and even sketches of apparatus...
Ngày tải lên: 16/02/2014, 22:20
Tài liệu Báo cáo khoa học: Spectroscopic characterization of a higher plant heme oxygenase isoform-1 from Glycine max (soybean) ) coordination structure of the heme complex and catabolism of heme docx
... oxyheme appeared at 540 and 579 nm. Then, a broad band appeared at around 660 nm, and was maximal 9–12 min after initiation of the reaction. The spectral features of the final reaction mixture were analogous, ... the axial heme ligand in rat heme oxygenase-1. Arch Biochem Biophys 317, 253–258. 21 Chu GC, Katakura K, Tomita T, Zhang X, Sun D, Sato M, Sasahara M, Kayama T, Ikeda-Saito M & Yoshida T ... coli. Plant Physiol 97, 1495–1401. 40 Onda Y, Matsumura T, Kimara-Ariga Y, Sakakibara T, Sugiyama T & Hase T (2000) Differential interaction of maize root ferredoxin:NADP + oxidoreductase with photosynthetic...
Ngày tải lên: 19/02/2014, 05:20
Tài liệu Báo cáo khoa học: Mutational analysis of plasminogen activator inhibitor-1 Interactions of a-helix F and its neighbouring structural elements regulates the activity and the rate of latency transition pdf
... the amount of PAI-1 required to inhibit half the uPA. The half-life of PAI-1 was finally calculated from an exponential decay plot of the data obtained. Generally, only one preparation of each PAI-1 ... an A increased the rate of latency transition more than twofold. Three variants, I13 7A, V14 2A, and N15 2A, had a biphasic loss of activity, one component with a significantly faster latency transition ... behaving as a substrate for uPA decreased approximately twofold for PAI-1(V12 6A) , PAI-1(F10 0A) , PAI-1(F12 8A) and PAI-1(W14 1A) with a concomitant increase in the fraction being inert to uPA. Substrate behaviour...
Ngày tải lên: 20/02/2014, 11:20
The impact of a cancer Survivorship Care Plan on gynecological cancer patient and health car provider reported outcomes (ROGY Care): study protocol for a pragmatic cluster randomized controlled trial potx
... status, and clinical variables such as cancer stage at diagnosis, time after diagnosis, and initial treat- ment. All measures will be collected at the beginning of the trial, and at 6, 12, 18 and ... Providing information that i s congruent with a patient ’sneedsat that particular time is an important determinant for patient satisfaction and affects health-related quality of life (HRQoL) and anxiety and ... sum- marize characteristics of both hospitals and patients. Characteristics of patients (i.e ., age, type of cancer, stage, treatment, so cio-economic status, marital statu s, educational level,...
Ngày tải lên: 05/03/2014, 15:20
Báo cáo khoa học: Crystal structure and enzymatic properties of a bacterial family 19 chitinase reveal differences from plant enzymes pdf
... L, Hamid Q & Elias JA (2004) Acidic mammalian chitinase in asthmatic Th2 inflammation and IL-13 pathway activation. Science 304, 1678– 1682. 4 Kasprzewska A (2003) Plant chitinases ) regulation ... equal amounts of (GlcNAc) 3 and (GlcNAc) 2 ; the 80 : 20 anomeric ratio of the products indicates that cleavage after sugar 2 or sugar 3 occurs approxi- mately equally often. Structure The overall ... Bio-Rad Protein Assay Kit (Bio-Rad, Hercu- les, CA, USA) with BSA as a standard. Analyses of the specific activity against chitooligosaccha- rides were performed in 100 lL reaction mixtures con- taining...
Ngày tải lên: 07/03/2014, 11:20
Báo cáo khoa học: Epl1, the major secreted protein of Hypocrea atroviridis on glucose, is a member of a strongly conserved protein family comprising plant defense response elicitors potx
... [e.g. cerato-platanin of Ceratocystis fimbriata f. sp. platani, Snodprot1 of Phaeosphaeria nodorum and Sp1 of Leptosphaeria maculans) or human allergens and path- ogenesis-related proteins (As-CG of ... several proprietary and public genomic databases using a tailor-made bioinformat- ics facility. The mascot search was run against all proteins and DNA sequence information from public databases V. ... conidia and hyphae of Ceratocystis fimbriata f. sp. Platani. FEMS Microbiol Lett 233, 341–346. 25 Pazzagli L, Cappugi G, Manao G, Camici G, Santini A & Scala A (1999) Purification, characterization,...
Ngày tải lên: 07/03/2014, 12:20
Báo cáo khoa học: Two types of replication protein A in seed plants Characterization of their functions in vitro and in vivo ppt
... (ATGGAGAACTCAGT GACCCAAGATGGTAT) and 70b R1 (AGAATTCTGAG GTTGAAGAAGCTAGTAA) primers, and 70b F2 (TACT ATCAGCAGAAGCAATGTGGTGATA) and 70b R2 (TTACTGAGATGTCTTGTTCTTGGAAATGT) primers for atrpa70b. As a control, A. thaliana ... (TGT AACCGAGATGGTCGGCAAC) and AtRPA7 0a- 3Â (AA CAGTCATCTTCACTCTTTGT); AtRPA70b-5Â (TTCAA CTTTGTACCCATTGAT) and AtRPA70b-3Â (TTCACCG CCATTATATACCTTA). These primers were used to obtain a fragment of 722 bp ... (AtRPA7 0a and AtRPA70b) A. thaliana was used for genetic analysis of the functions of OsRPA7 0a and OsRPA70b because it has closely rela- ted homologs (AtRPA7 0a and AtRPA70b, respectively) and because...
Ngày tải lên: 07/03/2014, 21:20