copy the directory structure found below usr lib locale iso 8859 1 to dir3 change director

Báo cáo khoa học: The crystal structure of a xyloglucan-speciﬁc endo-b-1,4glucanase from Geotrichum sp. M128 xyloglucanase reveals a key amino acid residue for substrate speciﬁcity potx

Ngày tải lên : 23/03/2014, 05:22

... the 20–2.5 A intensity data A randomly selected portion of the diffraction data (5.0%) was used to calculate the free R factor [20] The program coot [ 21] was used to display and correct the structure ... ADSC Quantum 210 CCD detector (Area Detector Systems ˚ Corporation, Poway, CA, USA) with 1. 0000 A radiation, and were processed using HKL2000 [16 ] and the ccp4 program suite [17 ] The structure ... mechanism [10 ,11 ] The exo activity of OXG-RCBH is based on a loop at one side of the active site cleft In addition, residue Asn488 in the active site cleft recognizes the Xyl side chain at the )1 site,...

7
361
0

The chart and graph below give information about sales and share prices for Coca

Ngày tải lên : 04/10/2012, 10:02

1
1.5K
1

Tài liệu Default and the Maturity Structure in Sovereign Bonds∗ docx

Ngày tải lên : 16/02/2014, 02:20

... 5 .11 6.08 6.40 9.25 10 .27 9.99 9.80 13 .55 13 .55 12 .23 11 . 61 21. 19 19 .11 15 .43 13 .85 Mexico 10 15 1. 87 2.87 3. 81 4 .19 1. 37 1. 10 1. 05 1. 09 0. 31 1. 81 2.55 2. 81 0.57 2. 01 2.86 3 .18 0.95 2.27 3.30 3.70 ... 3.76 8.30 11 .06 17 .02 3.45 4 .10 4.95 9.08 11 .49 16 .48 3.82 4.49 5. 41 9.44 11 .78 16 .58 Brazil 10 15 6. 01 7.69 8.04 8 .10 5.85 4.80 3.39 2.97 1. 47 5.36 5.89 5.92 2 .12 5.03 6 .12 6.47 2.75 5 .11 6.08 ... 25 10 10 5 10 years to maturity 15 20 Mexico 10 years to maturity 15 20 Russia 25 25 average 15 high short spread 20 15 spread (%) spread (%) 20 10 low short spread 10 5 10 years to maturity 15 ...

42
425
0

Tài liệu Đề tài " The causal structure of microlocalized rough Einstein metrics " pptx

Ngày tải lên : 16/02/2014, 05:20

... (t)λ 1 4ε0 ) dt Here we have used (11 1), (11 5), (11 8), (16 0), and the fact that r(t ) ≤ cr(t) for all t ≤ t, which follows from the comparison r(t ) ≈ t −u and the monotonicity of t − u along the ... Asymptotics Theorem We start by recalling already established estimates for the metric related quantities which play a crucial role in what follows ∂H (11 1) ∂H (11 2) (11 3) Ric(H) (11 5) D∗ ∂H s (11 6) ... r n(t − u) −L 2 1 − + M(∂H) + Θ 2 r n (t − u) r r 1 1 + − =2 r n(t − u) r n(t − u) + (M(∂H) + Θ) r = Thus using Corollary 6 .12 , (11 1), and (11 8) together with the estimate for the maximal function...

50
407
0

Tài liệu Banks’ exposure to interest rate risk, their earnings from term transformation, and the dynamics of the term structure pptx

Ngày tải lên : 16/02/2014, 06:20

... banks 20.2 12 .6 3.7 2.6 16 .2 6.9 Savings banks 54.2 36.2 11 .6 8.5 51. 8 29.2 Cooperative banks 61. 0 40.8 13 .3 10 .1 59.4 30.2 Other banks 16 .8 11 .6 3.5 2.2 11 .9 6.8 All banks 56 .1 37.7 12 .3 9.2 54.9 ... -0. 01 0 .10 0.0000 395 Between 0.30 0.74 0.0020 85 Within 0. 51* ** 0.02 0.3048 2 217 Between 0.59*** 0 .13 0.0408 458 Within 0.54*** 0. 01 0.36 01 5859 Between 0 .14 0.09 0.0 018 12 17 Within -0 .17 0 .18 ... (column 3) and the model with only the regulation variables (column 4) The R2 of the full model is 17 .24%, i.e the combined contribution of the systematic factor and the regulation to the total timely...

40
551
1

Tài liệu Báo cáo khoa học: Crystal structure of Klebsiella sp. ASR1 phytase suggests substrate binding to a preformed active site that meets the requirements of a plant rhizosphere enzyme doc

Ngày tải lên : 16/02/2014, 09:20

... 94.5 1. 65 1. 75 1. 65 P43 212 10 0 MAR IP 345 0. 810 0 50.0–2.57 2.65–2.57 P 212 1 21 110 Mar CCD 16 5 mm 13 3.69 13 3.69 11 1.24 644 348 5.7 15 .0 (2.60) 94 .1 (72.9) 6.9 (40.9) 81. 71 122.93 205.40 335 330 5 .1 ... 18 .0 (5.35) 98 .1 ( 81. 2) 8.2 (24.5) 94.5 1. 68 10 7 604 5643 (5.0%) 17 .98 ⁄ 20.63 49.2–2.57 62 787 3356 (5 .1% ) 19 .90 ⁄ 24.30 70 81 804 – 23.38 12 516 18 1 – – – 16 24 .11 0. 012 1. 31 5. 61 0.050 0. 010 ... group P43 212 Temperature (K) 10 0 Detector Mar CCD 16 5 mm Unit-cell parameters ˚ a (A) 13 4.00 ˚ b (A) 13 4.00 ˚ c (A) 11 1. 31 Measured reﬂections 511 747 Multiplicity 4.3 15 .1 (5. 21) Data...

13
766
0

Tài liệu Báo cáo khoa học: The crystal structure of human a-amino-b-carboxymuconatee-semialdehyde decarboxylase in complex with 1,3-dihydroxyacetonephosphate suggests a regulatory link between NAD synthesis and glycolysis ppt

Ngày tải lên : 18/02/2014, 06:20

... Apoptosis induced by niacin-related FEBS Journal 276 (2009) 6 615 –6623 ª 2009 The Authors Journal compilation ª 2009 FEBS 66 21 Crystal structure of human ACMSD 10 11 12 13 14 15 16 17 18 19 20 ... et al His His His 17 4 Asp 2 91 w1 DHAP B Met 19 5 w1 w 268 DHAP Leu 296 w 51 C1 Trp 19 1 Phe 294 centre into a small pocket delimited by residues Asp2 91, Trp1 91, Met195, Arg47 and the Phe294Pro295-Leu296 ... ˚ Mean B-factor protein (A2) ˚ Mean B-factor solvent (A2) ˚ Mean B-factor DHAP ⁄ Zn (A2) ˚ Mean B-factor glycerol atoms (A2) 2635 216 10 ⁄ 19 .3 25.6 0. 018 1. 6 15 .3 25.2 39.3 ⁄ 10 .1 25.6 corresponding...

9
796
0

Tài liệu Báo cáo khoa học: Structure of the putative 32 kDa myrosinase-binding protein from Arabidopsis (At3g16450.1) determined by SAIL-NMR docx

Ngày tải lên : 18/02/2014, 14:20

... 97.8 93.3 19 82 11 92 11 1 679 0 .18 13 8 13 6 2.6 12 4 1. 77 ± 0.56 )7508 ± 21 )2239 ± 30 89.0 9.5 1. 0 0.5 1. 12 ± 0 .19 1. 65 ± 0 .16 0.69 ± 0 .10 1. 08 ± 0.09 a The completeness of the 1H, 13 C and 15 N chemical ... M9 .1) GlcNAcb1-2Mana1-6 (GlcNAcb1-2Mana1-3) Manb1-4GlcNAcb1-4(Fuca1-6) GlcNAc (code no 210 .1) Galb1-4GlcNAcb1-2Mana1-6 (Galb1-4GlcNAcb1-2 Mana1-3)Manb1-4GlcNAcb1-4(Fuca1-6) GlcNAc (code no 210 .4) ... MBPfromB.napus1 -12 5 MBPfromB.napus194-336 MBPfromB.napus356-498 At1g52030.2 -15 4 At1g52030 .16 1-289 At1g52030.336-476 At3g16400.2 -14 2 At3g16440.2 -14 4 At3g16440 .15 4-300 At3g16470.2 -14 5 At3g16470 .15 8-297 At3g16470.308-450...

12
579
0

Tài liệu Báo cáo khoa học: "Understanding the Semantic Structure of Noun Phrase Queries" pptx

Ngày tải lên : 20/02/2014, 04:20

... Acc F1 65.6 84.7 70.8 87.4 72.4 89.7 75 .1 89.4 68 .1 81. 1 National Park Acc F1 61. 6 75.6 70.5 80.8 71. 1 82.3 75 .1 85.4 64.8 83.7 Average Acc F1 62 .1 78.9 69.4 82.8 72.2 85.0 74.8 86.5 65.4 81. 0 ... is to identify the semantic labels of IMs, i.e., the attribute names they implicitly refer to We use Ac to denote the set of IM semantic labels for the intent class c Other Additionally, there ... given the input, where the labels, denoted as y = (y1 , y2 , , yM ), yi ∈ Y, have a one -to- one correspondence with the word tokens in the input Using linear-chain CRFs, we aim to ﬁnd the label...

9
674
0

Tài liệu Báo cáo khoa học: The solution structure of reduced dimeric copper zinc superoxide dismutase doc

Ngày tải lên : 21/02/2014, 03:20

... regions REMa (30 structures) 0.02 51 ± 0.0 013 0. 012 4 ± 0.0 010 0. 014 9 ± 0.0009 0. 011 5 ± 0.0005 0. 014 7 ± 0.0004 1. 55 ± 0. 21 0.52 ± 0.24 0. 41 ± 0.26 51. 4 42.7 31. 9 52.8 17 8.7 8 .1 1.5 1. 3 71. 6 25.6 2.3 ... analysis of 2A Ó FEBS 2002 19 14 L Banci et al (Eur J Biochem 269) 10 11 12 13 14 15 16 17 18 19 20 21 22 structure of copper zinc superoxide dismutase J Mol Biol 16 0, 18 1– 217 Parge, H.E., Hallewell, ... (1H) · 88 (15 N) · 296 (1H) data points The 13 C-NOESY-HSQC was acquired with 10 24 (1H) · 11 2 (13 C) · 256 (1H) data points with spectral windows of 9 615 Hz (1H) · 19 230 Hz (13 C) · 9 615 Hz (1H) For...

11
575
0

Tài liệu Báo cáo khoa học: The crystal structure of coenzyme B12-dependent glycerol dehydratase in complex with cobalamin and propane-1,2-diol pptx

Ngày tải lên : 21/02/2014, 03:20

... cells b Total protein (mg) Speciﬁc activity (UÆmg )1) Yield (%) Puriﬁcation (fold) 12 400 11 500 10 500 8760 7780 823 376 18 5 14 1 11 9 15 .1 30.6 56.8 62 .1 65.4 10 0 93 85 71 63 2.0 3.8 4 .1 4.3 46 ... 0. 816 10 0 P 21 81. 4 10 8.2 11 3 .1 96.8 2.0 958 394 13 0 635 99.6 (97.6) 0.097 (0.38) 45.0–2 .1 113 453 99.9 0.208 0.248 R-factor=S||Fo| ) |Fc||/S|Fo| Rwork or the working R-factor is calculated on the ... 10 Masuda, J., Shibata, N., Morimoto, Y., Toraya, T & Yasuoka, N (2000) How a protein generates a catalytic radical from Ó FEBS 2002 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 Structure...

11
602
0

Tài liệu Báo cáo Y học: Molecular modeling of the dimeric structure of human lipoprotein lipase and functional studies of the carboxyl-terminal domain docx

Ngày tải lên : 21/02/2014, 15:20

... N291S are associated with increased plasma triglyceride and lower high-density lipoprotein cholesterol concentrations: 4 710 Y Kobayashi et al (Eur J Biochem 269) 10 11 12 13 14 15 16 17 18 19 ... bovine serum, 10 0 UÆmL )1 of penicillin, 10 0 lgÆmL )1 of streptomycin, and 0.25 lgÆmL )1 of amphotericin B Cells (1. 8 · 10 6) were plated onto a 10 -cm dish day before transfection The pMT2 vector containing ... type, whereas the K 413 A/K 414 A and K 414 A mutants, like the S132T mutant, lost esterase activity Next, the effects of the surface tryptophan substitutions at the C-terminal domain on the lipase and...

10
679
0

Tài liệu Báo cáo Y học: The solution structure and activation of visual arrestin studied by small-angle X-ray scattering pot

Ngày tải lên : 22/02/2014, 07:20

... wild-type protein (13 0 lM) further demonstrates that there is no change in low-angle scattering due to the R175Q mutation (Fig 4A) Thus, the R175Q mutation does not affect the quaternary structure of ... scattering from the grey structure, while the solid curve represents scattering from the black, structure The diﬀerence between scattering from the two structures is given in the top of the graph, ... identical to those observed for wild-type arrestin (data not shown), indicating that the R175Q mutation does not inﬂuence the monomer–dimer equilibrium Comparison of arrestinR175Q (11 0 lM) with the...

9
492
0

Publicly Funded Agricultural Research and the Changing Structure of U.S. Agriculture doc

Ngày tải lên : 06/03/2014, 15:20

... research, dedicated to the furtherance of science and technology and to their use for the general welfare Upon the authority of the charter granted to it by the Congress in 18 63, the Academy has ... 19 35 and 19 97, the number of farms has declined from 6.8 million to 1. 9 million, with most of the change occurring prior to 19 74 and leveling off after 19 74 (U.S Bureau of the Census, 19 00 19 92; ... (USDA, 19 96); The Relationship of Public Agricultural Research and Development to Selected Changes in the Farm Sector: A Report to the National Science Foundation (Busch, et al., 19 84); Report of the...

158
403
0

Báo cáo khoa học: The role of evolutionarily conserved hydrophobic contacts in the quaternary structure stability of Escherichia coli serine hydroxymethyltransferase pptx

Ngày tải lên : 07/03/2014, 03:20

... (min )1) Km /-Serd (mM) kcat /-Serd (min )1) 5 .11 5.88 5. 01 6.50 0 .14 0 .15 0.20 0.20 7.03 7 .16 4.35 11 .20 686.6 647.4 400.5 400.0 36.3 37.4 42.6 42 .1 202 .1 257.8 13 2.3 17 3.9 ± ± ± ± 1. 14 0.73 0.87 1. 69 ... 1. 69 ± ± ± ± 0. 01 0. 01 0. 01 0. 01 ± ± ± ± 0.88 1. 57 0.52 1. 34 ± ± ± ± 21. 7 36.3 10 .8 15 .3 ± ± ± ± 1. 4 2.9 1. 8 4.5 ± ± ± ± 4.2 13 .7 3.2 10 .7 a Dissociation constant of PLP binding equilibrium b Apparent ... Renwick SB, Snell K & Baumann U (19 98) The crystal structure of human cytosolic serine hydroxymethyltransferase: a target for cancer chemotherapy Structure 6, 11 05 11 16 21 Scarsdale JN, Kazanina G,...

12
578
0

Báo cáo khoa học: Eukaryotic class 1 translation termination factor eRF1 ) the NMR structure and dynamics of the middle domain involved in triggering ribosome-dependent peptidyl-tRNA hydrolysis pptx

Ngày tải lên : 07/03/2014, 05:20

... structure / w 16 1 ± )48 ± )20 16 0 )48 14 )40 ± 11 )90 ± 21 )64 )43 )60 13 12 8 ± 12 )63 ± 30 )70 13 0 )60 17 48 ± 68 )12 8 ± 93 )12 0 45 18 0 51 )4 ± 13 90 58 )22 ± 46 )62 ± 10 5 )63 )40 )60 10 4 )13 5 ... )13 5 ± 73 )87 )17 0 44 )23 ± 16 )63 )35 23 13 5 ± )11 0 ± 17 )75 13 5 )60 b 14 8 ± ± 11 0 )73 15 0 ) 41 ± )64 )42 b )42 ± )11 0 ± 23 )64 )42 The mean value in the family of 25 structures and the SD is no ... familya Residue / Pro177 Lys178 Lys179 His180 Gly1 81 Arg182 Gly183 Gly184 Gln185 Ser186 Ala187 Leu188 a )19 )72 )77 )12 8 80 )53 )66 )53 )90 )68 )64 )64 w ± ± ± ± ± ± ± ± ± ± ± ± v1 Torsion angles in...

15
538
0

Báo cáo khoa học: The crystal structure of NlpI A prokaryotic tetratricopeptide repeat protein with a globular fold potx

Ngày tải lên : 07/03/2014, 16:20

... PEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTY 13 1 14 2 14 6 15 9 8.9 12 .2 (TPR3) )15 3.0 +26.5 16 .2 (pair 3–4) YAHLNRGIALYYGGRDKLAQDDLLAFYQDDPND 16 4 17 7 17 9 19 2 14 .6 3.9 +16 3.3 +26.9 96.2 (pair 4–5) PFRSLWLYLAEQKLDEKQAKEVLKQHFEKSDKEQW 10 11 ... 79, 80, 83 2.5 Helix 11 212 , 216 16 Helix 12 237, 240, 244 Helix 13 255, 258, 259,2 61, 262, 264, 266 16 Helix 14 2 71, 275, 278 2.45 Total 38 FEBS Journal 272 (2005) 16 6 17 9 ª 2004 FEBS C G M ... J 17 , 11 92 11 199 15 Abe Y, Shodai T, Muto T, Mihara K, Torii H, Nishikawa S, Endo T & Kohda D (2000) Structural basis of presequence recognition by the mitochondrial protein import receptor Tom20...

14
433
0

Báo cáo khoa học: "Understanding the thematic structure of the Qur’an: an exploratory multivariate approach" pdf

Ngày tải lên : 08/03/2014, 04:22

... 3 316 3543 26 81 2895 312 7 11 56 Sura name Al-Israa Al-Kahf Ta-Ha Al-Anbiyaa Al-Hajj Al-Nur Al-Shu'araa Words 14 64 14 89 12 65 10 77 11 95 12 36 12 08 Al-Tawba Yunus Hud Yusuf Al-Nahl 2345 17 32 18 09 16 65 ... Everitt (20 01) , Gordon (19 99; 69 -10 9), and Gore (2000) For briefer discussions see Dunn and Everitt (20 01; 12 5 -16 0), Hair et al (19 98; 469 518 ), Flynn et al (19 99; 275-9), Kachigan (19 91; 2 61- 70), ... comparing the profiles The general procedure for thematic interpretation of the cluster tree, therefore, is to work through the levels of the tree from the top, constructing and comparing thematic...

6
309
0

Báo cáo khoa học: Molecular mass of macromolecules and subunits and the quaternary structure of hemoglobin from the microcrustacean Daphnia magna ppt

Ngày tải lên : 16/03/2014, 13:20

... 3393–3 410 ª 2006 The Authors Journal compilation ª 2006 FEBS 3407 Structure of Daphnia magna hemoglobin 10 11 12 13 14 15 16 17 18 19 20 21 22 T Lamkemeyer et al central mechanism of adaptation to ... composition [2,4,8 ,11 ,12 ,42] offers the chance to relate the structure and function of this interesting molecule The present study has contributed to this approach: (a) the determination of the molecular ... compilation ª 2006 FEBS T Lamkemeyer et al Structure of Daphnia magna hemoglobin A C1 C2 A1 A2 B1 B2 F1 F2 D1 D2 * control B C1 C2 A1 A2 B1 B2 * F1 F2 D1 D2 de-N C * de-O D * de-N/O Fig Mobility...

18
499
0

The Economic Structure of Intellectual Property Law pot

Ngày tải lên : 16/03/2014, 15:20

... 65–67 (19 74 [19 34]) 17 09 according to the calendar then in use; 17 10 according to the modern calendar See Lyman Ray Patterson, Copyright in Historical Perspective (19 68) Authorizing Congress to “promote ... 16 24, the petition of the English Stationers’ Company to Parliament in 16 43,2 the Statute of Anne (the English Copyright Act of 17 10),3 the patent and copyright clause of the U.S Constitution of 17 87,4 ... 346.7304′8—dc 21 2003050882 Contents Introduction 1 The Economic Theory of Property How to Think about Copyright A Formal Model of Copyright Basic Copyright Doctrines 11 Copyright in Unpublished Works 37 71...

449
460
1