... TPBIA merit further investigation as a potential candidate as an antipsychotic agent with novel and clinically important properties A putative combination of dopaminergic antagonism and antioxidant ... Polar Surface Area (PSA) of a molecule is defined as the area of its van der Waals surface that arises from oxygen and nitrogen atoms as well as hydrogen atoms attached to oxygen or nitrogen atoms ... TPBIA Low energy conformation and van der Waals surface of comLow energy conformation and van der Waals surface of compound TPBIA Page of (page number not for citation purposes) Annals of General...
Ngày tải lên: 08/08/2014, 20:23
... study, ANA staining, saliva collections, data analyses, and manuscript preparation All authors read and approved the final manuscript Proposed genetic predisposition for and fatty acid homeostasis/trans6.NOD-Aec1Aec2 ... O-acyltransferase-1 (SOAT-1) using FCs and free fatty acids (FFAs) ABCA1, ATP-binding cassette, subfamily A [ABC1] member 1; ACAT, acyl-coenzyme A: cholesterol acyltransferase; ApoE, apolipoprotein ... primarily the pathophysiological and biochemical abnormalities that subsequently result in the activation of the autoimmune attack against the submandibular and lacrimal glands [10], is a single...
Ngày tải lên: 09/08/2014, 13:22
Báo cáo y học: "Lassa virus-like particles displaying all major immunological determinants as a vaccine candidate for Lassa hemorrhagic fever" ppt
... Statistical analysis of data was performed with GraphPad InStat, V3.06 (GraphPad Software, Inc., San Diego, CA), using Analysis of Variance (ANOVA), paired or unpaired Student’s t test, and Pearson’s ... regulatory advantage for this platform as a vaccine candidate Administration of pseudoparticles containing autologous Page 13 of 19 ribosomes to vaccinees has potential to result in untoward immunological ... procedure was scaled down to a 96well format, with each condition analyzed in triplicate Data was plotted as mean absorbance at 562 nm, with standard deviation, and background correction at 650 nm Page...
Ngày tải lên: 12/08/2014, 01:22
Tài liệu Commodity-Linked Bonds: A Potential Means for Less-Developed Countries to Raise Foreign Capital doc
... Monetary and Financial Analysis Department Bank of Canada Ottawa, Ontario, Canada K 1A 0G9 jattamensah@bankofcanada.ca The views expressed in this paper are those of the author No responsibility for ... Ottawa, Ontario K 1A 0G9 E-mail: publications@bankofcanada.ca Web site: http://www.bankofcanada.ca Diffusion des publications, Banque du Canada 234, rue Wellington, Ottawa (Ontario) K 1A 0G9 Adresse ... Bank of Canada Working Papers Documents de travail de la Banque du Canada Working papers are generally published in the language of the author, with an abstract in both official languages Les...
Ngày tải lên: 16/02/2014, 02:20
Tài liệu Báo cáo khoa học: Cell surface nucleolin on developing muscle is a potential ligand for the axonal receptor protein tyrosine phosphatase-r ppt
... of anti-placental alkaline phosphatase-agarose (anti-PLAP; Sigma) was packed into an FPLC column (Amersham Biosciences, Chalfont St Giles, UK) Purification of FN3d–AP was carried out using an AKTA ... Frisen J, Yates PA, McLaughlin T, Friedman GC, O’Leary DD & Barbacid M (1998) Ephrin -A5 (AL1 ⁄ RAGS) is essential for proper retinal axon guidance and topographic mapping in the mammalian visual system ... cleavage sites (B) SDS ⁄ PAGE separation of FN3d–AP purified from conditioned media using anti-placental alkaline phosphatase (PLAP) agarose (C) SDS ⁄ PAGE and silver stain of proteins isolated...
Ngày tải lên: 19/02/2014, 05:20
Tài liệu BÁO CÁO " LIPID PRODUCTION FROM MICROALGAE AS A PROMISING CANDIDATE FOR BIODIESEL PRODUCTION " ppt
... 48 MAKARA, TEKNOLOGI, VOL 13, NO 1, APRIL 2009: 47-51 energy crops [6-7] Microalgae systems also use far less water than traditional oilseed crops For these reasons, microalgae are capable of ... per unit area of land, compared to terrestrial oilseed crops Microalgae are very efficient biomass capable of taking a waste (zero energy) form of carbon (CO2) and converting it into a high density ... extracted The effect of drying temperature was investigated in this study Gas chromatography analysis Sample was dissolved in ethyl acetate and 0.5 µL of this was injected into a Shimadzu GC-17A...
Ngày tải lên: 21/02/2014, 10:20
Tài liệu BÁO CÁO " LIPID PRODUCTION FROM MICROALGAE AS A PROMISING CANDIDATE FOR BIODIESEL PRODUCTION " docx
... 48 MAKARA, TEKNOLOGI, VOL 13, NO 1, APRIL 2009: 47-51 energy crops [6-7] Microalgae systems also use far less water than traditional oilseed crops For these reasons, microalgae are capable of ... per unit area of land, compared to terrestrial oilseed crops Microalgae are very efficient biomass capable of taking a waste (zero energy) form of carbon (CO2) and converting it into a high density ... extracted The effect of drying temperature was investigated in this study Gas chromatography analysis Sample was dissolved in ethyl acetate and 0.5 µL of this was injected into a Shimadzu GC-17A...
Ngày tải lên: 21/02/2014, 10:20
Báo cáo khoa học: Distribution of the extrinsic proteins as a potential marker for the evolution of photosynthetic oxygen-evolving photosystem II ppt
... text for details), although it was not detected by the immunological assays Psb P Cyanobacteria Glaucophyceae Red algae Diatoms Haptophyceae Brown algae Prasinophyceae Euglenophyceae Green algae ... Cyanobacteria Synechocystis sp PCC6803 Rhodophyceae (red algae) Cyanidioschyzon merolae Nuclear DNA Chloroplast DNA Cyanidium caldarium Chloroplast DNA Bacillariophyceae (diatoms) Thalassiosira pseudonana ... gyrans (B), Laminria japonica (C) and Undaria pinnatifida (D) with antibodies raised against various extrinsic proteins Lane 1, anti-(H-PsbP); lane 2, anti-(H-PsbQ); lane 3, anti-(G-PsbQ); lane...
Ngày tải lên: 23/03/2014, 15:21
Báo cáo hóa học: " HPV vaccine: an overview of immune response, clinical protection, and new approaches for the future" pdf
... pseudovirion-based neutralization assay] stated that for any age strata positivity rates for anti -HPV- 16 and -18 neutralizing antibodies in cervicovaginal secretions and circulating HPV- 16 and -18 ... Costa Rica Br J Cancer 2004, 91:1269-1274 Ferris D, Garland S, for the Quadrivalent HPV Vaccine Investigators: Evaluation of quadrivalent hpv 6/11/16/18 vaccine efficacy against cervical and anogenital ... Efficacy of human papillomavirus (HPV) -16/18 AS04-adjuvanted vaccine against cervical infection and precancer caused by oncogenic HPV types (PATRICIA): final analysis of a double-blind, randomised...
Ngày tải lên: 18/06/2014, 16:20
Báo cáo hóa học: " Cathepsin B: a potential prognostic marker for inflammatory breast cancer" ppt
... Hoda Ismail (Department of Pathology, National Cancer Institute, Cairo University, Giza, Egypt) for her assistance in reviewing and scoring of pathology slides We also thank Ms A Dhiaa Alraawi and ... (pro-uPA) uPA activate plasminogen a serine protease that can digest ECM proteins and activate MMPs, a family of proteolytic enzymes that are also major participants in ECM degradation and cancer cell ... rafts and caveolin-1 are required for invadopodia formation and extracellular matrix degradation by human breast cancer cells Cancer Res 2009, 69:8594-8602 Mohamed MM, Cavallo-Medved D, Sloane...
Ngày tải lên: 18/06/2014, 16:20
Báo cáo hóa học: " Optimization of capsid-incorporated antigens for a novel adenovirus vaccine approach" doc
... motif- AAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEA NSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAA SGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ SNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEK ... GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ PEVEKPQKKP TEQGGGGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAA APAAQPEVEKPQKKPVIKPL Core Arg-Gly-Asp (RGD) motif italicized ... CGGGATCCCGGTTTCTTCTGAGGCTTCTCG CGGGATCCGGTGGCGCAGGCGG 83RGD -(as) 83RGD - (a) CGGGATCCCAGGGGTTTGATCACCGGTTT CGGGATCCACCGAACAGGGCGGGG 3'HVR5-(as) 5'HVR2-(s) GGCATGTAAGAAATATGAGTGTCTGGG CTCACGTATTTGGGCAGGCGCC a antisense,...
Ngày tải lên: 20/06/2014, 01:20
Báo cáo hóa học: " A quantum dots and superparamagnetic nanoparticle-based method for the detection of HPV DNA" ppt
... Capture probe 5-GAGGAGGATGAAATAGATGGTCCAGCTGG ACAAGCAGAACCGGACAGAGCCCATTACAATAT TGTAACCTTTTGTTGCAAGTGTGACTCT ACGCTTCGGT-3 Secondary probe 5-GGAGCGACCCAGAAAGTTACCACAGTTATGC ACAGAGCTGCAAACAACTA-3 ... extraction of DNA of the samples and simple incubation as well as magnetic separation, which has a good acceptability for any average lab assistant Table Comparison between QDs and superparamagnetic ... primer TGT GCT GCC ATA TCT ACT TCA GAA ACT AC Type-specific PCR lower primer TAG ACC AAA ATT CCA GTC CTC CAA A Yu-Hong et al Nanoscale Research Letters 2011, 6:461 http://www.nanoscalereslett.com/content/6/1/461...
Ngày tải lên: 21/06/2014, 01:20
Báo cáo hóa học: " Research Article Infinitely Many Solutions for a Semilinear Elliptic Equation with Sign-Changing Potential" potx
... “Infinitely many bound states for some nonlinear scalar field equations,” Calculus of Variations and Partial Differential Equations, vol 23, no 2, pp 139–168, 2005 W Kryszewski and A Szulkin, “Generalized ... 2 Boundary Value Problems a nontrivial solution of P in a situation where f x, u and V x are periodic in the xvariable, f x, u is superlinear at u and ±∞, and lies in a spectral gap of −Δu ... lemma is the same as 6, Lemma 3.2 For the completeness, we prove it Lemma 3.2 Under the assumptions A1 , A2 , A3 , and A4 , I satisfies the P S -condition in X Proof By Lemma 3.1, we know that any...
Ngày tải lên: 21/06/2014, 20:20
Báo cáo hóa học: " Research Article A Potential Transmitter Architecture for Future Generation Green Wireless Base Station" potx
... OFDM signals OFDM is a noise-like signal with a random path in the I and Q plane, any near zero crossings cause large dips in the envelope signal and a large rate of phase change (instantaneous ... sigma delta modulators (MOD [9]), amplitude and a phase quantisers, and a polar to “PWM/PPM” block The Cartesian signals pass through ΣΔ filters, after which they are converted to polar [R, θ] for ... Cartesian ΣΔ clearly outperforms the polar ΣΔ, leading to a lower n requirement for the same ACP The results shown here for n = are reasonable for the WLAN standard (ACP < −40 dB) However a higher...
Ngày tải lên: 21/06/2014, 22:20
Báo cáo hóa học: "EXISTENCE OF SOLUTIONS FOR A NONLINEAR ELLIPTIC DIRICHLET BOUNDARY VALUE PROBLEM WITH AN INVERSE SQUARE POTENTIAL" potx
... Differential Equations 195 (2003), no 2, 497–519 [3] J P Garc a Azorero and I Peral Alonso, Hardy inequalities and some critical elliptic and parabolic ı problems, Journal of Differential Equations ... Nonlinear Differential Equations and Their Applications, 24, Birkh¨ user Boston, Massachusetts, 1996 a Shenghua Weng: Department of Mathematics, Fujian Normal University, Fuzhou 350007, China E-mail ... Provincial Natural Science Foundation of China (A0 410015) S Weng and Y Li References [1] A Capozzi, D Fortunato, and G Palmieri, An existence result for nonlinear elliptic problems involving critical...
Ngày tải lên: 22/06/2014, 22:20
Báo cáo hóa học: "Research Article Harnack Inequality for the Schrödinger Problem Relative to Strongly Local Riemannian p-Homogeneous Forms with a Potential in the Kato Class" potx
... Milano, Piazza Leonardo Da Vinci 32, Italy; Accademia Nazionale delle Scienze detta dei XL, Via L Spallanzani 7, Italy Email address: marbir@mate.polimi.it Silvana Marchi: Dipartimento di Matematica, ... Riemannian p-homogeneous forms; we define a suitable notion of Kato class of measures We assume that the potential is a measure in the Kato class and we prove a Harnack inequality (on balls that are ... della Accademia Nazionale delle Scienze detta dei XL Memorie di Matematica e Applicazioni [12] M Biroli and P G Vernole, “Strongly local nonlinear Dirichlet functionals and forms,” Advances in Mathematical...
Ngày tải lên: 22/06/2014, 22:20
Báo cáo y học: "Fluvoxamine for aripiprazole-associated akathisia in patients with schizophrenia: a potential role of sigma-1 receptors" ppt
... Ishikawa M, Ishiwata K, Ishii K, Kimura Y, Sakata M, Naganawa M, Oda K, Miyatake R, Fujisaki M, Shimizu E, Shirayama Y, Iyo M, Hashimoto K: High occupancy of sigma-1 receptors in the human brain after ... sigma-1 receptors in the efficacy of fluvoxamine for akathisia Author details Department of Psychiatry, Asahikawa Red Cross Hospital, Asahikawa, Japan Division of Clinical Neuroscience, Chiba University ... with antipsychotic treatment Aripiprazole is an antipsychotic drug that acts as a partial agonist at dopamine D receptors and serotonin 5hydroxytryptamine (5-HT) 1A receptors, and an antagonist at...
Ngày tải lên: 08/08/2014, 23:21
Báo cáo y học: "Complement C3 serum levels in anorexia nervosa: a potential biomarker for the severity of disease" pdf
... severe forms of anorexia nervosa Upon primary medical stabilization, patients are transferred to a psychiatrically based inpatient eating disorder program further treatment and follow-up Patients and ... the traditional activation cascade using C3 convertases or C5 convertases [13] As a result, C 5a may be generated via thrombin-mediated coagulation abnormalities that have been documented in anorexia ... power of our statistical analysis and make our data vulnerable to a statistical type II error Therefore, our data not allow for advocating complement serum levels as a new biomarker until definitively...
Ngày tải lên: 09/08/2014, 01:21
Báo cáo y học: "tatin-induced expression of CD59 on vascular endothelium in hypoxia: a potential mechanism for the anti-inflammatory actions of statins in rheumatoid arthritis" pptx
... UK) Statistical analysis All data were expressed as the mean of the individual experiments ± the standard error of the mean Data were analysed using one-way or two-way analysis of variance with ... Capell HA, Sattar N: Trial of Atorvastatin in Rheumatoid Arthritis (TARA): double-blind, randomised placebo-controlled trial Lancet 2004, 363:2015-2021 Palmer G, Chobaz V, Talabot-Ayer D, Taylor ... tissue factor procoagulant activity J Exp Med 1997, 185:1619-1627 36 Collard CD, Agah A, Reenstra W, Buras J, Stahl GL: Endothelial nuclear factor-kappaB translocation and vascular cell adhesion...
Ngày tải lên: 09/08/2014, 08:22
Báo cáo y học: "Three-dimensional and thermal surface imaging produces reliable measures of joint shape and temperature: a potential tool for quantifying arthritis" pdf
... Maldonado-Cocco J, Orozco-Alcala J, Prieur AM, Suarez-Almazor ME, Woo P, International League of Associations for Rheumatology: International League of Associations for Rheumatology classification ... participated in its design and coordination, and helped to draft the manuscript All authors read and approved the final manuscript Acknowledgements The authors thank Taschawee Arkachaisri, Daniel ... thermal imaging of the wrist and MCP, normal adult wrists and hands from controls were imaged on separate days Three thermal scans were obtained at each session and the HDI was calculated for each...
Ngày tải lên: 09/08/2014, 10:22