boundary layers and related topics

... study of FEA for EVs and structural analysis assemblies Running gear design for optimum performance and lightweight Lightweight vehicle suspension Handling and steering Traction and braking systems ... body-structure and chassis-systems He returned to industry for a short period, as a technology communicator, first Product Affairs Manager for Leyland Truck and Bus, then technical copywriter and sales ... review past and present EV design package trends, and in his second two chapters on body construction and body-structural/running-gear design, uses his earlier industrial experience in body and running-gear...

Ngày tải lên: 05/03/2014, 15:20

... study of FEA for EVs and structural analysis assemblies Running gear design for optimum performance and lightweight Lightweight vehicle suspension Handling and steering Traction and braking systems ... body-structure and chassis-systems He returned to industry for a short period, as a technology communicator, first Product Affairs Manager for Leyland Truck and Bus, then technical copywriter and sales ... review past and present EV design package trends, and in his second two chapters on body construction and body-structural/running-gear design, uses his earlier industrial experience in body and running-gear...

Ngày tải lên: 22/03/2014, 12:20

... study of FEA for EVs and structural analysis assemblies Running gear design for optimum performance and lightweight Lightweight vehicle suspension Handling and steering Traction and braking systems ... body-structure and chassis-systems He returned to industry for a short period, as a technology communicator, first Product Affairs Manager for Leyland Truck and Bus, then technical copywriter and sales ... review past and present EV design package trends, and in his second two chapters on body construction and body-structural/running-gear design, uses his earlier industrial experience in body and running-gear...

Ngày tải lên: 27/06/2014, 17:20

... study of FEA for EVs and structural analysis assemblies Running gear design for optimum performance and lightweight Lightweight vehicle suspension Handling and steering Traction and braking systems ... body-structure and chassis-systems He returned to industry for a short period, as a technology communicator, first Product Affairs Manager for Leyland Truck and Bus, then technical copywriter and sales ... review past and present EV design package trends, and in his second two chapters on body construction and body-structural/running-gear design, uses his earlier industrial experience in body and running-gear...

Ngày tải lên: 27/06/2014, 17:20

... GLUT1 and GLUT3 (exons 3–8), and four in human GLUT2 (exons 7–10) and GLUT4 (exons 6–9) (Table 1) The codons for arginine (96) and valine (231) in gcGLUT (Fig 2) are split between exons and 5, and ... (between exon and exon 5) and valine (between exons and exon 7) are shown Exonic regions are shown in uppercase and intronic regions are in lowercase The split codons are boxed and highlighted ... 2-phenoxyethanol (0.05% v/v) for min, and killed by a blow to the head Tissues were then dissected out and snap-frozen in liquid nitrogen, and stored at )80 °C Animal care and experiments were conducted...

Ngày tải lên: 17/03/2014, 03:20

... respectively), and mapped on tubulin secondary ` structure as determined by Inclan and Nogales [47] Arrows and rectangles indicate b-sheets and a-helices, respectively The labels ÔLÕ and ÔMÕ indicate ... mM MgCl2 and mM dithiothreitol Mt-cpn60 and Cof A purifications were performed as described previously [15,28] In vitro folding assays and competition experiments In vitro folding assays and analysis ... lane 1) and of CCT purified from rabbit reticulocyte lysate (2 lg and lg in lanes and 3, respectively) Lanes and were Western blotted and immunostained by an anti-(TCP-1a) polyclonal Ig Lane was Coomassie...

Ngày tải lên: 23/03/2014, 21:20

... lecture topics and tutorial activities; (3) resources and Web links which includes links to a number of Australian and international Web sites related to the topics covered in the subject; and, ... considering past practices and experiences of the subject lecturer; reviewing HIV/AIDS and nutrition teaching resource kits; and, identifying and reviewing Web sites related to HIV/AIDS and nutrition ASCILITE ... protocols and tools were developed to collect quantitative and qualitative data Pre and post tests related to HIV/AIDS and nutrition will allow for quantitative comparison of knowledge, attitude and...

Ngày tải lên: 28/03/2014, 21:20

... and MNN2 is the client IPerf reports the amount of transferred data and used bandwidth Additionally, the GPS patch appends location information (latitude and longitude) as well as the offset and ... 361, 489, 400 600 Time (seconds) 1000 −10 800 200 Bandwidth (Kbits/sec) −10 800 200 200 Bandwidth (Kbits/sec) 1200 Bandwidth (Kbits/sec) 1200 1000 Bandwidth (Kbits/sec) 1200 −5 Time (seconds) Average ... each trial considered in the segment, and a bold line shows the average bandwidth One can notice the two different bandwidth patterns obtained at corners and straight roads Communication performance...

Ngày tải lên: 21/06/2014, 08:20

... rectangular pulse waveform with unit amplitude and duration τ, ωq and φq are the frequency and random phase of the qth subcarrier, respectively, and c(k) (t) is the spreading sequence of user ... integer less than or equal to x Assuming a passband null-to-null bandwidth, the transmission bandwidth for the SC-DS-CDMA is 2/Tc Maintaining this bandwidth, if the chip duration on each subcarrier ... second moment and βq (t) is uniformly distributed (k) over and 2π It is assumed that the channel gain ζq (t) is independent and identically distributed (i.i.d.) for different values of k and q This...

Ngày tải lên: 22/06/2014, 19:20

... there is no change in kinetics and potential energies, and that all heat fluxes and the shaft work are zero except for the heat fluxes respective to the reaction and to the cooling d (ρVr H ) ... experiments and was 0.0045 This value was almost 12.5 times higher than the value of kwirges For experiments and 6, the mean value was 0.000707 and it was times higher than kwirges Experiments and were ... solution with hydrogen peroxide and ferrous ions is known as Fenton’s reagent and is used for the initiation of polymerizations, hydroxylation of aromatic derivatives and oxidative couplings, among...

Ngày tải lên: 22/07/2014, 03:20

... contributions MS and JMG designed the assays and strategies for its analysis, MS performed all library preparation and characterization, MS, DL and MP performed bisulfite validation studies, while QJ and ... CGdepleted promoters (such as OCT4 [17]) and CpG island shores [18], and within gene bodies where cytosine methylation has been found to be positively correlated with gene transcription [15] It ... strengths of MSCC and HELP-seq/Methylseq, and the supporting analytical workflow that maximizes the quantitative capabilities of the data generated Results and discussion Library preparation and sequencing...

Ngày tải lên: 09/08/2014, 20:21

... 3) Additional file 3: PDA Chromatograms standard compounds (A) and a XST injection (C), and total ion current chromatograms of standard compounds (B) and a XST injection (D) 1-27 were the characteristic ... file 5, 6, 7, and 9) Ten saponins, namely R1, ginsenoside Rg1, Re, Rb1, Rg2, Rh1, Rb2, Rd, 20(S)-Rg3 and 20(R)-Rg3 were quantitatively determined and the rest 17 saponins without standard references ... performed the fingerprint and quantitative analysis and wrote the manuscript PYS and QS assisted HY to identify the characteristic peaks using HPLC-PDA/ESI-MSn All authors read and approved the final...

Ngày tải lên: 13/08/2014, 14:20

... plane joint angles, moments and powers for the hip and knee during level walking Shown are average values (solid line), one standard deviation in average value (gray band), and average foot off (vertical ... motion state based on joint angles and ground reaction force (GRF) information [29] They have shown it effectiveness in sit-to-stand and standto-sit transfers [29], and in supporting walking [30] ... shown to lower muscle activations of the knee flexors during sit-to-stand and stand-to-sit transfers [29], and the hip flexors and extenders during walking [30] Similarly, MIT’s exoskeleton addresses...

Ngày tải lên: 09/09/2015, 11:13

... it is easy to understand that for the same packet, its CSIT and CSIR are different, or say, decorrelated due to the delay This is a practical and general model for the design and performance analysis ... ABEP-based and the BEOP-based power control laws for the imperfect CSI case For both the ABEP-based and the BEOP-based power control laws, we derive explicit ABEP and BEOP results under perfect CSI and ... Our design and analysis of the ABEP-based and the BEOP-based power control laws are generalized for both BPSK and quadrature phase shift keying (QPSK) modulations 1.2.2 Receiver Design and Performance...

Ngày tải lên: 10/09/2015, 08:25

... QFRs In the following, a literature review of QFRs and some related topics will be given 1.2 Review of Quadratic-Form Receivers and Related Topics The quadratic-form receiver is one of the most ... a sum of independent random variables, each of which corresponds to a channel and is a weighted sum of norm squares and cross terms of two correlated, complex Gaussian random variables [24–29] ... Marcum Q-function Q(a, b) and its upper and lower bounds versus b for the case of b ≥ a = 159 4.19 The first-order Marcum Q-function Q(a, b) and its upper and lower bounds versus b...

Ngày tải lên: 14/09/2015, 11:19

... process and forward the received signals at the relay The most common strategies are amplify -and- forward (AF) and decode -and- forward (DF) Other strategies include compress -and- forward (CF) and selection ... communication, especially in the last decade Consequently, the demand for bandwidth and capacity becomes more and more urgent, and the fading problem has never been so critical The capacity of ... allocation and the equal power allocation, with η = 90% and ζ = 80%, 70%, 50% and 0%, respectively 2.9 40 43 Case I: BEP results for the conventional and the optimum SBS receivers, 2Tx and 2Rx...

Ngày tải lên: 14/09/2015, 14:05

... adenocarcinomas overexpress EGF-family ligands (such as transforming growth factor-α (TGF-α) and EGF) and receptors (EGFR, ERBB2 or Her2/neu, and ERBB3) (36,38,41) EGFR and ERBB2 induction occurs in low-grade ... localization and function of this gene 3) Clone the promoter of this gene and understand the basal transcriptional regulation of its expression 34 MATERIALS AND METHODS 3.1 MICROARRAY AND IDENTIFICATION ... 1.2.6 Expressed Sequence Tags (ESTs) and SAGE 1.3 Biology of PKC and TPA 1.3.1 Cell Growth and Tumour Promotion 1.3.2 PKCs and Pancreatic Cancer 1.4 Biology of Transmembrane/...

Ngày tải lên: 14/09/2015, 22:09

... 1985, and Exclusive Economic Zone Act, 1984), vessel operation and conduct (The Merchant Shipping Ordinance, 1952), land use pattern (National Land Code, 1965, and Land Conservation Act, 1960), and ... alluvial tin and sand, caused widespread degradation of areas with mineral deposits leaving behind sandy, barren and unfertile land, unattended water bodies, and silted waterways Landslips, particularly ... regulations stipulate the standards and procedures for handling the various types of domestic and industrial wastes Stakeholders and Water Resource Management The conservation, use, and management of water...

Ngày tải lên: 06/03/2014, 15:21

... II and III, the only physical connection between domains G and II and domains III, IV and V In the S aureus EF-G structure, this loop has a bent conformation, and packs against domain III and ... helices AV and BV at the surface of domain V Gly621 and Gly617 are in the area of contact with the 1095 and 2473 regions of 23S RNA The two helices are facing the ribosome, and the four-stranded b-sheet ... of molecules A and B form an extended b-sheet, and helix AV packs in an antiparallel fashion to the equivalent helix in molecule B Residues 2–38, 64–441 and 445–692 in molecule A and residues 2–41,...

Ngày tải lên: 06/03/2014, 22:21

... fibronectin (Fn), and use these as a bridge between the bacterial surface and host cell receptors [12] S aureus MSCRAMMs that bind to collagen, Fn and fibrinogen have been identified and characterized ... form in body fluids and in an insoluble, fibrillar form in the extracellular matrix Its main functions include cell adhesion and spreading, regulation of cell shape and migration, and differentiation ... and functional features of the Fn-binding moieties of FnBPA and FnBPB NYQFGGHNSVDFEEDTLPQVSGHNEGQQTIEEDTTP High-affinity binding sites for full-length Fn and its N-terminal fragment in FnBPA and...

Ngày tải lên: 06/03/2014, 22:21