... malformation - H-bond acceptor Positive Negative Frequency 20 10 0 H-bond acceptor Human functional deficit - H-bond acceptor Positive Negative Frequency 20 10 0 H-bond acceptor Human developmental ... Human death - hydrogen bonding Positive Negative Frequency 10 0 10 20 Hydrogen bonding 30 Human malformation - hydrogen bonding Positive Negative Frequency 10 0 10 20 Hydrogen bonding 30 Human functional ... Human developmental toxicants - H-bond acceptor Frequency 20 10 0 H-bond acceptor Human growth retardation - H-bond acceptor Positive Negative Frequency 20 10 0 H-bond acceptor Human death - H-bond...
Ngày tải lên: 12/08/2014, 00:21
Statistical Description of Data part 1
... paper copy for their own personal use Further reproduction, or any copying of machinereadable files (including this one) to any servercomputer, is strictly prohibited To order Numerical Recipes books,diskettes, ... IN C: THE ART OF SCIENTIFIC COMPUTING (ISBN 0-521-43108-5) Copyright (C) 1988-1992 by Cambridge University Press.Programs Copyright (C) 1988-1992 by Numerical Recipes Software Permission is granted ... association for two distributions We want to determine whether two variables are “correlated” or “dependent” on one another If they are, we want to characterize the degree of correlation in some...
Ngày tải lên: 20/10/2013, 17:15
Statistical Description of Data part 2
... paper copy for their own personal use Further reproduction, or any copying of machinereadable files (including this one) to any servercomputer, is strictly prohibited To order Numerical Recipes books,diskettes, ... paper copy for their own personal use Further reproduction, or any copying of machinereadable files (including this one) to any servercomputer, is strictly prohibited To order Numerical Recipes books,diskettes, ... finding that value xi which has equal numbers of values above it and below it Of course, this is not possible when N is even In that case it is conventional to estimate the median as the mean of the...
Ngày tải lên: 24/10/2013, 15:15
Statistical Description of Data part 3
... void avevar(float data[], unsigned long n, float *ave, float *var); float betai(float a, float b, float x); float var1,var2,svar,df,ave1,ave2; avevar(data1,n1,&ave1,&var1); avevar(data2,n2,&ave2,&var2); ... avevar(float data[], unsigned long n, float *ave, float *var); float betai(float a, float b, float x); unsigned long j; float var1,var2,ave1,ave2,sd,df,cov=0.0; avevar(data1,n,&ave1,&var1); avevar(data2,n,&ave2,&var2); ... avevar(data1,n,&ave1,&var1); avevar(data2,n,&ave2,&var2); for (j=1;j
Ngày tải lên: 24/10/2013, 15:15
Statistical Description of Data part 4
... whether two somethings have different distributions in longitude (See also [8].) We will leave to you the coding of routines analogous to ksone, kstwo, and probks, above (For λ < 0.4, don’t try ... have some quantitative measure of the strength of the association One often hears this loosely stated as the question of whether two variables are correlated or uncorrelated, but we will reserve ... data points to the left of a given value x This function is obviously constant between consecutive (i.e., sorted into ascending order) xi ’s, and jumps by the same constant 1/N at each xi (See...
Ngày tải lên: 28/10/2013, 22:15
Statistical Description of Data part 5
... column size) minus the number of constraints that have arisen from our use of the data themselves to determine the nij Each row total and column total is a constraint, except that this overcounts ... The value H is conventionally termed the entropy of the distribution given by the pi ’s, a terminology borrowed from statistical physics So far we have said nothing about the association of two ... quantities (xi , yi ), i = 1, , N , the linear correlation coefficient r (also called the product-moment correlation coefficient, or Pearson’s r) is given by the formula (xi − x)(yi − y) i r= (xi...
Ngày tải lên: 28/10/2013, 22:15
Statistical Description of Data part 6
... the ranks There is, of course, some loss of information in replacing the original numbers by ranks We could construct some rather artificial examples where a correlation could be detected parametrically ... case of complete correlation void pearsn(float x[], float y[], unsigned long n, float *r, float *prob, float *z) Given two arrays x[1 n] and y[1 n], this routine computes their correlation coefficient ... Find the means Compute the correlation coefficient Sample page from NUMERICAL RECIPES IN C: THE ART OF SCIENTIFIC COMPUTING (ISBN 0-521-43108-5) Copyright (C) 1988-1992 by Cambridge University Press.Programs...
Ngày tải lên: 07/11/2013, 19:15
Statistical Description of Data part 7
... *probrs=0.0; free_vector(wksp2,1,n); free_vector(wksp1,1,n); 643 14.6 Nonparametric or Rank Correlation concordant − discordant √ τ= √ concordant + discordant + extra-y concordant + discordant + extra-x ... vard,t,sg,sf,fac,en3n,en,df,aved,*wksp1,*wksp2; wksp1=vector(1,n); wksp2=vector(1,n); for (j=1;j
Ngày tải lên: 07/11/2013, 19:15
Statistical Description of Data part 8
... parent However, extensive Monte Carlo integrations have shown that the distribution of the twodimensional D is very nearly identical for even quite different distributions, as long as they have the ... paper copy for their own personal use Further reproduction, or any copying of machinereadable files (including this one) to any servercomputer, is strictly prohibited To order Numerical Recipes books,diskettes, ... paper copy for their own personal use Further reproduction, or any copying of machinereadable files (including this one) to any servercomputer, is strictly prohibited To order Numerical Recipes books,diskettes,...
Ngày tải lên: 07/11/2013, 19:15
... (resolver gearbox denominator) MD 31080: DRIVE_ENC_RATIO_NUMERA (resolver gearbox denominator) S MD 32810: EQUIV_SPEEDCTRL_TIME (speed control loop equivalent time constant for feedforward control) ... disabled for the drive immediately The speed control of the drive should be maintained for this time to make sure that the axis/spindle can come to a standstill from maximum traversing velocity or speed ... always active after the “Standstill monitoring delay time” has elapsed, provided that no new traversing command is active The standstill monitoring is active for axes and a position - controlled...
Ngày tải lên: 13/12/2013, 01:16
Tài liệu Statistical Description of Data part 9 pptx
... a[1+(ipj+imj)/2][1+(ipj-imj)/2]=sum; } ludcmp(a,m+1,indx,&d); Solve them: LU decomposition for (j=1;j
Ngày tải lên: 15/12/2013, 04:15
Tài liệu APPENDIX Description of the Extraordinary Measures pdf
... savings bonds would only eliminate increases in debt that would count against the debt limit if the securities were issued Moreover, suspending such sales conserves very little headroom.6 Second, ... Finally, for both legal and practical reasons, sale of the government’s portfolio of student loans is not feasible For these reasons, Secretaries of the Treasury of both parties have concluded that ... Federal employees covered by the Civil Service Retirement System The fund is invested in special-issue Treasury securities, which count against the debt limit Congress has given Treasury statutory...
Ngày tải lên: 16/02/2014, 11:20
Tài liệu Lombard Street: A Description of the Money Market docx
... great calamity, everybody is suspicious of everybody; as soon as that calamity is forgotten, everybody again confides in everybody On the Continent there has been a stiff controversy as to whether ... shall be solvent or insolvent This may seem too strong, but it is not All banks depend on the Bank of England, and all merchants depend on some banker If a merchant have 10,000 L at his bankers, ... Bank of England certainly could not have made But no one in London ever dreams of questioning the credit of the Bank, and the Bank never dreams that its own credit is in danger Somehow everybody...
Ngày tải lên: 17/02/2014, 19:20
Tài liệu Báo cáo khoa học: Characterization of ICAM-4 binding to the I domains of the CD11a/CD18 and CD11b/CD18 leukocyte integrins pptx
... [42] However, the adhesion of both ICAM-4 positive and negative erythrocytes to coated CD11b I domain was almost completely abrogated in the presence of mAb 60.1, which binds to the recombinant ... highly active in competing with the coated ICAM-4Fc for the recombinant I domain GST fusion proteins and the soluble ICAM-1Fc and ICAM-2Fc fusion proteins were even more efficient competitors ... receptor and thus preventing the conformational change to the active high affinity form The activation-independent mAbs LM2/1 and 904 have indeed been suggested to recognize a common or overlapping epitope...
Ngày tải lên: 20/02/2014, 11:20
Tài liệu Báo cáo khoa học: "An Implemented Description of Japanese: The Lexeed Dictionary and the Hinoki Treebank" ppt
... /を/運転1 /す る /人1 /。 Someone who drives a car H YPERNYM 人1 hito “person” S EM C LASS 292:chauffeur/driver (⊂ 5:person ) W ORD N ET driver1 D EFINITION ... grammar (Head Driven Phrase Structure Grammar) we could simultaneously annotate syntactic and semantic structure without overburdening the annotator The treebank records the complete syntacto-semantic ... “driver” ¯ is given in Figure The third reason was that use of the grammar as a base enforces consistency — all sentences annotated are guaranteed to have well-formed parses The last reason was...
Ngày tải lên: 20/02/2014, 12:20
Tài liệu The Description of Wales pot
... and such person may choose to alternatively give you a replacement copy If you received it electronically, such person may choose to alternatively give you a second opportunity to receive it electronically ... of Owen; Owen, son of Gruffydd; Gruffydd, son of Conan; Conan, son of Iago; Iago, son of Edoual; Edoual, son of Meyric; Meyric, son of Anarawt (Anandhrec); Anarawt, son of Mervin, son of Roderic ... of South Wales: Rhys, son of Gruffydd; Gruffydd, son of Rhys; Rhys, son of Tewdwr; Tewdwr, son of Eineon; Eineon, son of Owen; Owen, son of Howel Dda, or Howel the Good; Howel, son of Cadell, son...
Ngày tải lên: 21/02/2014, 21:20
Tài liệu Title: Elizabethan England From ''''A Description of England,'''' by William Harrison pptx
... twenty-five years' labour at his scheme Then the men who were to have borne the cost of printing the Universall Cosmographie were afraid to face the expense of the whole work, and resolvd to only so ... Not that William Harrison was a countryman by birth He was a Cockney of the Cockneys, born right beneath Bow Bells themselves; but when you come to gather the threads of his connections, you seem ... the government of the commonwealth he meddleth little), whatsoever it cost him, he will both array and arm himself accordingly, and shew the more manly courage, and all the tokens of the person...
Ngày tải lên: 21/02/2014, 21:20
Báo cáo Y học: Novel fish hypothalamic neuropeptide Cloning of a cDNA encoding the precursor polypeptide and identification and localization of the mature peptide pptx
... probe, which is complementary to a sequence of antisense probe Competitive enzyme-linked immunosorbent assay (ELISA) Because the deduced peptide precursor encoded three putative LPXRFamide peptides ... VKDWAPKIKMNKPVVNKMPPSAANLPLRF-NH2) has been isolated as one of the bovine RFRPs [15] Collectively, these peptides identified from the brain of several vertebrates are characterized by the LPXRF-NH2 ... study, peptide levels in the brain were quantified by a competitive ELISA using the antifGRP serum [11] This anti-fGRP serum was confirmed to recognize specifically three putative goldfish LPXRFamide...
Ngày tải lên: 08/03/2014, 16:20
History and Comprehensive Description of Loudoun County, Virginia pot
... 670 slave-holders in the following proportions: slave 124 slaves 84 slaves 61 slaves 83 slaves 46 slaves 39 slaves 35 slaves 27 slaves 22 10 and under 15 slaves 80 15 and under 20 slaves 36 20 ... Carbonate of Copper, from vein 3' wide, developed to 25' deep Assays by Oxford Copper Company of New York give 51 per cent of copper and 27 ounces of silver per ton Sulphuret of Copper, from vein ... cost of this publication would have been considerably augmented As it is I have been spared the expense and labor that would have attended an enforced personal investigation of the County's soils...
Ngày tải lên: 08/03/2014, 22:20