b p tan k s mai and y l liu 2004 apparent digestibility of selected feed ingredients for juvenile cobia rachycentron canadum aquaculture vol 241 issues 1 4 pages 441 451
Tài liệu I MMIGRANT S MALL B USINESS OWNERS: A S IGNIFICANT AND G ROWING PART OF THE E CONOMY pdf
Ngày tải lên :
18/02/2014, 00:20
... a business is likely to be relatively FPI June 2 012 Immigrant Small Business Owners Small businesses Small businesses—privately held firms with between and 99 employees—are an important part of ... firms) 1- 99 employees (small businesses) 10 0 -49 9 employees 500 or more Publicly held firms, nonprofits, and others not classifiable by ownership Total with employees at time of survey Small businesses ... percent of the 11 7 million people the SBO reports working for all businesses—publicly held, nonprofit, and privately held firms.* [Figure 1. ] And, small businesses are responsible for $6 trillion...
- 37
- 436
- 0
Factors influencing borrower’s behavior and decision making patterns in the success of a micro finance model
Ngày tải lên :
06/09/2013, 05:48
... countries Every society possesses some form of social class which is important to the MFIs because the behavior of people in a given social class is similar In this way financing activities could be ... terms and the losses are shared accordingly Expertise, knowledge of the business, wisdom and long range planning can surely make the probability of success at the highest level The concept of musharika ... respondents in classified group ‘A’ were found to be engaged as employees, mainly in private sector as labor class at worker level positions They can also be attracted towards entrepreneurship by offering...
- 23
- 552
- 0
The Use of Selected Medicinal Herbs for Chemoprevention and Treatment of Cancer, Parkinson’s Disease, Heart Disease, and Depression
Ngày tải lên :
25/10/2013, 05:20
... whole, wild Alaska Vaccinium ovalifolium Sm (Alaska early blueberry), V alaskaense How (Alaska black huckleberry), V uliginosum L subsp alpinum (Bigel.) Hult (Alpine blueberry), and V uliginosum ... SP60 012 5 for JNK) specifically blocked LPS-induced COX-2 expression Thus, it appears LPS-induced COX-2 expression by activating MAPK pathways, and delphinidin suppressed COX-2 by blocking MAPK-mediated ... Administration of pterostilbene significantly suppressed AOMinduced formation of ACF and multiple clusters of aberrant crypts Importantly, dietary pterostilbene also suppressed AOM-induced colonic...
- 57
- 683
- 0
Báo cáo y học: "ISsaga is an ensemble of web-based methods for high throughput identification and semiautomatic annotation of insertion sequences in prokaryotic genomes" pdf
Ngày tải lên :
09/08/2014, 22:24
... /locus_tag="AM1_0 019 “ 19 516 20 316 /locus_tag="AM1_0 019 “ /product="transposase ISAcma5, IS5 ssgr IS10 31 family“ /translation="MPTAYDSDLTTLQWELLEPLIPAAKPGGRPRTTDMLSVLNAIFY LVVTGCQWRQLPHDFPCWSTVYSYFRRWRDDGTWVHINEHLRMQERVSEDRHPSPSAA ... /translation="MPTAYDSDLTTLQWELLEPLIPAAKPGGRPRTTDMLSVLNAIFY LVVTGCQWRQLPHDFPCWSTVYSYFRRWRDDGTWVHINEHLRMQERVSEDRHPSPSAA ICDAQSVKVGNPRCHSIGFDGGKMVKGRKRHVLVDTLGLVLMVMVTAANISDQRGAKI LFWKARRQGASLSRLVRIWADAGYQGQALMKWVMDRFQYVLEVVKRSDNLAGFQVVSK ... dispersion in two subspecies of Leifsonia xyli BMC Microbiol 2008, 8 :12 7 16 Pop M, Phillippy A, Delcher AL, Salzberg SL: Comparative genome assembly Brief Bioinform 20 04, 5:237- 248 17 Parkhill...
- 9
- 672
- 0
Báo cáo y học: "Investigating the complementary value of discrete choice experiments for the evaluation of barriers and facilitators in implementation research: a questionnaire survey" pptx
Ngày tải lên :
11/08/2014, 05:21
... oncologist has been the specialist who analyses the type of breast pathology presented Preventive procedures, early diagnosis of non-palpable lesions, breast conserving therapy, and lymph node sparing ... anaesthesiologists were expected to respond suboptimally because this group of health care professionals is less closely associated with the subject of the survey compared to surgical oncologists ... analysis of complex multiattribute judgment problems Adv Consum Res 19 84, 11 : 14 8 -15 5 Page 11 of 12 (page number not for citation purposes) Implementation Science 2009, 4 :10 12 13 14 15 16 17 18 ...
- 12
- 398
- 1
Báo cáo y học: "Response to: Cytokine profile of autologous conditioned serum for treatment of osteoarthritis, in vitro effects on cartilage metabolism and intra-articular levels after injection – authors’ reply" ppt
Ngày tải lên :
12/08/2014, 15:22
... Arthritis Research Ther 2 010 , 12 :R 1 14 Darabos N, Hundric-Haspl Z, Haspl M, Markotic A, Darabos A, Moser C: Correlation between synovial fluid and serum IL-1beta levels after ACL surgery-preliminary ... Netherlands 2Faculty of Veterinary Sciences, Utrecht University, Yalelaan 1, De Uithof, 35 84 CL Utrecht, The Netherlands Published: 17 December 2 010 References Moser C: Response to: Cytokine profile ... Rutgers et al Arthritis Research & Therapy 2 010 , 12 : 41 1 http://arthritis-research.com/content /12 /6/ 41 1 up ACS-based randomized controlled trials with full patient and observer blinding and with...
- 2
- 311
- 0
Young people’s experience and perception in community violence the case of kebele 45, woreda 4, kirkossub city
Ngày tải lên :
14/08/2017, 15:56
... of crimes They also often display other problems, such as truancy and dropping out of school, substance abuse, compulsive lying, reckless driving and high rates of sexually transmitted diseases, ... Young Peoples Experience And Perception Young people s experience and perception in community violence: The Case of Kebele 45 , Woreda 4, KirkosSub City By: SelamawitYinessu A Thesis proposal ... in-depth information, this study has used multiple case study Multiple case study enable the researcher to use multiple cases to a single issue as well as multiple cases from a multiple research sites...
- 90
- 204
- 0
Some aspects of American culture and society in the twentieth and twenty-first centuries through a number of selected short literary works
Ngày tải lên :
07/11/2012, 15:01
... ideas of life, science and his explanation of the relationship among people, their customs, religion or so “All he possesses” includes all his material property, his family, his relationship with ... Lester, Buck and Big Boy, the main character, who are as naughty and lovely as any boys in the world walking “lollingly in bare feet, beating tangled vines and bushes with long sticks” (Schorer, p. 885), ... to see the shows on television such as “the all-colored world of Amos and Andy” which is full of black lawyers, black doctors and nurses “We were starved for images of ourselves and searched TV...
- 49
- 785
- 1
Addressing the Impact of Household Energy and Indoor Air Pollution on the Health of the Poor: Implications for Policy Action and Intervention Measures pot
Ngày tải lên :
15/03/2014, 16:20
... Association of exposure with chronic bronchitis [assessed by symptoms] and chronic obstructive pulmonary disease [COPD - progressive and incompletely reversible airways obstruction] (assessed by spirometry ... (DALYs) lost 3.2 Estimates of Global Mortality and DALYs Lost Table shows the deaths, illness incidence and DALYs lost calculated using the fuel-based method | 17 Addressing the Impact of Household ... circumstances • Be sustainable, i.e local production should be reinforced to secure a sustainable supply of stoves, ovens and accessories by local stove fitters, potters or smithies (promotion of local...
- 52
- 578
- 0
Báo cáo lâm nghiệp: "Across-site heterogeneity of genetic and environmental variances in the genetic evaluation of Eucalyptus globulus trials for height growth" ppt
Ngày tải lên :
08/08/2014, 00:21
... e Silva et al [4] The data comprised 45 parents, 92 full-sib families and 46 6 clones within full-sib families The average numbers of crosses per parent and clones per full-sib family were and ... observations pre-adjusted by scale transformations MATERIALS AND METHODS 2 .1 Plant material and field trials This study used 3-year-old height data from six E globulus trials with clonally replicated ... GB and GS are expected genetic responses to selection under the base and simpler models, respectively GB and GS were calculated as averages of PBVs for the individuals selected by each model,...
- 9
- 392
- 0
Báo cáo thú y: "A study on the applicability of implantable microchip transponders for body temperature measurements in pigs." pptx
Ngày tải lên :
12/08/2014, 18:22
... Witek B, Kamyczek M, Tokarski J: Stress-induced enhancement of activity of lymphocyte lysosomal enzymes in pigs of different stress-susceptibility J Physiol Pharmacol 2006, 57: 61- 72 Despopoulos ... piglets Apmis 19 99, 10 7:9 21- 928 Axelsson M, Dang Q, Pitsillides K, Munns S, Hicks J, Kassab GS: A novel, fully implantable, multichannel biotelemetry system for measurement of blood flow, pressure, ... in pigs Phys Beh 19 95, 57 :10 51- 1055 Jensen-Waern M, Nyberg L: Valuable indicators of physical stress in porcine plasma Zbl Vet Med A 19 93, 40 :3 21- 7 Stojek W, Borman A, Glac W, Baracz-Józwik B, ...
- 9
- 328
- 0
Báo cáo y học: "TCMGIS-II based prediction of medicinal plant distribution for conservation planning: a case study of Rheum tanguticum" ppt
Ngày tải lên :
13/08/2014, 14:20
... plant species distributions: future challenges Perspect Plant Ecol Evol Syst 2008, 9 :13 7 -15 2 doi :10 .11 86 /17 49 -8 546 -5- 31 Cite this article as: Yu et al.: TCMGIS-II based prediction of medicinal plant ... wild relatives: status and trends Biodivers Conserv 20 04, 13 :663-6 84 10 Shinwari ZK, Gilani SS: Sustainable harvest of medicinal plants at Bulashbar Nullah, Astore (Northern Pakistan) J Ethnopharmacol ... Arundel ST: Using spatial models to establish climatic limiters of plant species’ distributions Ecol Model 2005, 18 2 :15 9 -18 1 24 Chefaoui RM, Hortal J, Lobo JM: Potential distribution modelling,...
- 9
- 310
- 0
Báo cáo y học: "Protein-lipid interactions: correlation of a predictive algorithm for lipid-binding sites with three-dimensional structural data" ppt
Ngày tải lên :
13/08/2014, 23:20
... Resolution (Å) Refinement PDB ID Included (R-value) Homo sapiens 2 74 746 Bos taurus 15 4 34 31 Gallus gallus 2–2 71 Gallus gallus 19 6 40 0 Gallus gallus 200 40 0 Gallus gallus 8 81 10 612 Homo sapiens ... phospholipids [30] Phosphoinositides, such as phosphatidylinositol 3 ,4, 5-trisphosphate (PIP3) and phosphatidylinositol 4, 5-bisphosphate (PIP2), differentially regulate alpha-actinin flexibility and ... collar (Lys 911 Ala and Lys924Ala) or ladder (Lys952Ala) reduce PIP2 binding by 50% The ladder is largely solvent exposed, although at its amino-terminal end Lys 944 and Arg 945 make salt bridges...
- 14
- 244
- 0
An Examination of the Pupil, Classroom and School Characteristics Influencing the Progress Outcomes of Young Maltese Pupils for Mathematics
Ngày tải lên :
11/10/2014, 03:58
... Collation of Data 11 1 Table 5.2 The Pupil Level Variables 11 5 Table 5.3 The Classroom Level Variables 11 6 Table 5 .4 The School Level Variables 11 8 Table 5.5 Estimating the Number of Pupils for ... All Pupils are Able to Learn 11 .2 .1. 1 Pupil Level Predictors of Pupil Attainment (Age 6) and Pupil Progress 2 91 11. 2 .1. 2 Classroom and School Level Predictors of Pupil Attainment (Age 6) and Pupil ... Maths 15 8 Table 6.9 Mean Age and Age Pupil Outcomes by Sex 16 0 Table 6 .10 Mean Age and Age Outcomes for TypicallyDeveloping Pupils and At Risk Pupils Table 6 .11 Mean Age and Age Pupil Outcomes by...
- 389
- 246
- 0
TEACHING FOR EXPERIENTIAL LEARNING AND ITS APPLICATION TO THE VOCATIONAL TRAINING OF CIVIL ELECTRICAL SERVICES FOR RURAL LABORERS
Ngày tải lên :
15/09/2015, 15:17
... understand, deeply remember the problems Especially learners may have high flexibility in adapting and handling problems with the skills learned - The feedback of teachers: All teachers involved ... VT for rural workers 1. 2.3 .1 Psychological basis of TFEL in VT for rural workers Marxist Psychology confirms that human psychology is essentially active In other words, human psychology, including ... civil electricity particular profession 3 .1. 2 Testing and assessment mission The test on the basis of a number of lessons of the typical vocational electrical civil for rural workers by TFEL; processing,...
- 28
- 278
- 0
effects of natural foods on food selection and growth rates of cobia (rachycentron canadum) larvae
Ngày tải lên :
22/09/2015, 16:45
... (Lepomis cyanellus) and bluegill fry (Lepomis macrochirus) selected for Cyclops vernalis and consistently selected against cladoceran egg cases and Potamocypris spp Moina brachiata was consistently ... consistently selected for by bluegills but was initially consumed by green sunfish in approximately the same proportion as they were available and later preferentially selected for by larger green sunfish ... laterally and white ventrally; black lateral band as wide as eye extends from snout to base of caudal fin, bordered above and below by paler bands; below this is a narrower dark band Black lateral...
- 60
- 550
- 0