b crystal structure of ru l4 2 pf6 2 ch3cn
Tài liệu Báo cáo khoa học: The crystal structure of human a-amino-b-carboxymuconatee-semialdehyde decarboxylase in complex with 1,3-dihydroxyacetonephosphate suggests a regulatory link between NAD synthesis and glycolysis ppt
... 23 24 25 26 27 28 29 30 31 32 33 34 35 a-amino -b- carboxymuconate-e-semialdehyde decarboxylase (ACMSD) J Biol Chem 27 7, 351 62 35167 Tanabe A, Egashira Y, Fukuoka SI, Shibata K & Sanada H (20 02) ... Apoptosis induced by niacin-related FEBS Journal 27 6 (20 09) 6615–6 623 ª 20 09 The Authors Journal compilation ª 20 09 FEBS 6 621 Crystal structure of human ACMSD 10 11 12 13 14 15 16 17 18 19 20 S Garavaglia ... (A) Observations Unique reflections Rmerge Multiplicity Completeness (%) 2. 0 63 794 24 525 0. 124 2. 6 94 Number of protein atoms Number of solvent molecules Number of DHAP ⁄ Zn atoms Number of glycerol...
- 9
- 796
- 0
Tài liệu Báo cáo khoa học: The crystal structure of coenzyme B12-dependent glycerol dehydratase in complex with cobalamin and propane-1,2-diol pptx
... 21 22 23 24 25 26 27 28 29 Structure of B1 2- dependent glycerol dehydratase (Eur J Biochem 26 9) 4493 coenzyme B1 2: X-ray structure of diol dehydratase-adeninylpentylcobalamin complex Structure ... (604 ± 32) d 0 .27 ± 0.10 (24 4 ± 23 )d 4490 M Yamanishi et al (Eur J Biochem 26 9) Ó FEBS 20 02 Fig Structure of glycerol dehydratase in complex with cobalamin and propane-1 ,2- diol (A) Overall structure ... dehydrataseÆcobalamin Ó FEBS 20 02 Structure of B1 2- dependent glycerol dehydratase (Eur J Biochem 26 9) 4491 Fig Structures of the active site and the cobalamin-binding site (A) Stereo drawing of the active-site...
- 11
- 602
- 0
Báo cáo khoa học: Crystal structure of basic 7S globulin, a xyloglucanspecific endo-b-1,4-glucanase inhibitor protein-like protein from soybean lacking inhibitory activity against endo-b-glucanase doc
... Yoshizawa et al Structure of Bg7S, a XEGIP-like protein of soybean Structured digital abstract l Bg7S binds to Bg7S by x-ray crystallography (View interaction) l Bg7S binds to Bg7S by cosedimentation ... Journal 27 8 (20 11) 1944–1954 ª 20 11 The Authors Journal compilation ª 20 11 FEBS 1945 Structure of Bg7S, a XEGIP-like protein of soybean T Yoshizawa et al Fig Structure of Bg7S from soybean (A) ... supposedly stabilize the three-dimen- Structure of Bg7S, a XEGIP-like protein of soybean sional structure of Bg7S The Cys209–Cys418 bond seems to be significant for stabilization in particular, because...
- 11
- 524
- 0
Báo cáo khoa học: The crystal structure of a xyloglucan-specific endo-b-1,4glucanase from Geotrichum sp. M128 xyloglucanase reveals a key amino acid residue for substrate specificity potx
... (0.199) 26 7 8 42 43 425 98.4 (93 .2) 6 .2 (6.0) 17.9 (8.6) 20 2. 5 (2. 56 2. 5) 0 .23 6 (0 .25 1) 0 .27 6 (0 .29 6) 676 107 0.015 1.64 a Numbers in parentheses are values for the highest-resolution ˚ ˚ shell: 2. 59 2. 5 ... assessing the accuracy of crystal structures Nature 355, 4 72 475 21 Emsley P & Cowtan K (20 04) Coot: model-building tools for molecular graphics Acta Crystallogr D 60, 21 26 21 32 22 Potterton L, McNicholas ... Brumer H & Davies GJ (20 06) Crystal structures of Clostridium thermocellum xyloglucanase, XGH74A, reveal the structural basis for xyloglucan recognition and degradation J Biol Chem 28 1, 24 922 24 933...
- 7
- 361
- 0
Báo cáo khoa học: Crystal structure of a cold-adapted class C b-lactamase potx
... quality of protein structures J Appl Crystallogr 26 , 28 3 29 1 51 Lambert C, Leonard N, De Bolle X & Depiereux E (20 02) ESyPred3D: prediction of protein 3D structures Bioinformatics 18, 125 0– 125 6 52 ... J Biol Chem 27 8, 37015–37 023 Bae E & Phillips GN Jr (20 04) Structures and analysis of highly homologous psychrophilic, mesophilic, and thermophilic adenylate kinases J Biol Chem 27 9, 28 2 02 28 208 ... 0.9797 10 )2. 2 P21 ˚ ˚ a = 43.6 A, b = 69.7 A, ˚ c = 53.9 A, b = 90.9° 57 181 (7667) 15 724 (20 38) 95.4 (99.9) 3.8 (6.1) 23 .94 (16. 62) 99 2. 2 17 .2 ⁄ 25 .4 34.90 34.53 35.66 0.005 ⁄ 0. 020 89.3 ⁄...
- 11
- 341
- 0
Crystal structure of arabidopsis thaliana cyclophilin 38 (atcyp38 2
... YDGMEIQRSD TEKTRTVPLE YKAQVVIPFN VFWLLKESEL NEDFLADLKV YKIAG 437 1 12 1 42 1 72 2 02 2 32 2 62 2 92 322 3 52 3 82 4 12 Figure 28 The sequence of AtCyP38 (83-437) The native methionine residues are highlighted ... Cytochrome b5 62 is about 10% identical and aligns with an R.M.S.D of 1.73 for 83 residues, Fig 32 A B Figure 32 Structure overlap for the helical bundle of AtCyP38 with (A) PsbQ and (B) cytochrome b5 62 ... MIEKLEAGMQDMLKIVEDRKRDAVAPKQKEILKYVGGIEEDMVDGFPYE 180 190 21 0 20 0 β3 22 0 β4 α6 VPEEYRNMPLLKGRASVDMKVKIKDNPNIEDCVFRIVLDGYNAPVTAGN 23 0 25 0 24 0 26 0 27 0 β5 α6 FVDLVERHFYDGMEIQRSDGFVVQTGDPEGPAEGFIDPSTEKTRTVPLE 28 0 300 29 0 310 320 β6 IMVTGEKTPFYGSTLEELGLYKAQVVIPFNAFGTMAMAREEFENDSGSS...
- 36
- 182
- 0
Structural basis of protein stability at poly extreme crystal structure of amya at 1 6 a resolution 2
... Table 2. 3 Table 2. 3 Coordinating atoms of calcium and distances Calcium No Interacting Atoms ASP 44 OD1 ASP 46 OD1 ASP 48 OD1 ILE 50 O ASP 52 OD2 WAT 27 Distance in Å 2. 47 2. 49 2. 50 2. 45 2. 48 2. 70 ... collection and crystallographic statistics are summarized in Table 2. 1 40 Figure 2. 5 lAmyA crystal picture Crystals of AmyA, with maximum dimensions of 0.1 x 0.1 x 0.6 mm Table 2. 1 Crystal parameters ... until the structure was refined to an R-factor of 0 .20 1 and an Rfree of 0 .22 1 using reflections with |F| > σ(|F|) The calcium and chloride ions were modeled by the use of both the 2| Fo|-|Fc|...
- 33
- 290
- 0
Tài liệu Báo cáo khoa học: Crystal structure of an ascomycete fungal laccase from Thielavia arenaria – common structural features of asco-laccases ppt
... 0 .2 61 ± 2. 7 ± 0.1 FEBS Journal 27 8 (20 11) 22 83 22 95 ª 20 11 The Authors Journal compilation ª 20 11 FEBS J P Kallio et al Crystal structure of a Thielavia arenaria laccase Fig (A) The crystal structure ... increases A typical feature of basidiomycete laccases is FEBS Journal 27 8 (20 11) 22 83 22 95 ª 20 11 The Authors Journal compilation ª 20 11 FEBS 22 89 Crystal structure of a Thielavia arenaria laccase ... pre-equilibrated in mM Tris ⁄ HCl FEBS Journal 27 8 (20 11) 22 83 22 95 ª 20 11 The Authors Journal compilation ª 20 11 FEBS 22 91 Crystal structure of a Thielavia arenaria laccase J P Kallio et al buffer...
- 13
- 888
- 0
Tài liệu Báo cáo khoa học: Crystal structure of importin-a bound to a peptide bearing the nuclear localisation signal from chloride intracellular channel protein 4 ppt
... NLS binding J Biol Chem 27 5, 21 218 21 223 Kobe B (1999) Autoinhibition by an internal nuclear localization signal revealed by the crystal structure of mammalian importin alpha Nat Struct Biol ... of the C-terminal domain of influenza virus polymerase PB2 subunit Nat Struct Mol Biol 14, 22 9 23 3 24 Yang SN, Takeda AA, Fontes MR, Harris JM, Jans DA & Kobe B (20 10) Probing the specificity of ... signals by karyopherin alpha Structure 8, 329 –338 22 Fontes MR, Teh T, Jans D, Brinkworth RI & Kobe B (20 03) Structural basis for the specificity of bipartite nuclear localization sequence binding by...
- 14
- 741
- 0
Tài liệu Báo cáo khoa học: Crystal structure of the cambialistic superoxide dismutase from Aeropyrum pernix K1 – insights into the enzyme mechanism and stability pdf
... FEBS 607 Crystal structure of SOD from A pernix K1 17 18 19 20 21 22 23 24 25 26 27 608 T Nakamura et al philic archaeon, Aeropyrum pernix J Biochem 126 , 21 8 22 5 Whittaker MM & Whittaker JW (20 00) ... (1.38–1.35) 1 529 91 (10838) 18.8 (23 .9) ⁄ 20 .3 (25 .4) 0.008 1.170 6 823 18 734 49.75–1.48 (1. 52 1.48) 113539 (7965) 22 .6 (29 .5) ⁄ 25 .6 ( 32. 7) 0.0 12 1.3 82 6855 10 417 24 .5 39.1 14.8 27 .6 10.1 21 .0 28 .4 16.0 ... Number of intrasubunit ion pairs ⁄ residue Number of intersubunit ion pairs ⁄ tetramer Number of intersubunit ion pairs ⁄ residue SsoSOD 0.033 0. 024 24 0. 028 24 0. 029 ApSOD TthSOD 14 0.066 22 ...
- 12
- 762
- 0
Tài liệu Báo cáo khoa học: Crystal structure of Klebsiella sp. ASR1 phytase suggests substrate binding to a preformed active site that meets the requirements of a plant rhizosphere enzyme doc
... FEBS Journal 27 7 (20 10) 128 4– 129 6 ª 20 10 The Authors Journal compilation ª 20 10 FEBS 128 7 Crystal structure of Klebsiella phytase PhyK A Tyr249 Thr2 92 K Bohm et al ¨ Tyr249 Thr2 92 Asp291 Asp291 ... species FEBS Journal 27 7 (20 10) 128 4– 129 6 ª 20 10 The Authors Journal compilation ª 20 10 FEBS K Bohm et al ¨ Crystal structure of Klebsiella phytase PhyK Binding model A crystal structure of the ... considerable freedom of substrate binding and release outside the catalytic site of PhyK FEBS Journal 27 7 (20 10) 128 4– 129 6 ª 20 10 The Authors Journal compilation ª 20 10 FEBS K Bohm et al ¨ Crystal structure...
- 13
- 766
- 0
Tài liệu Báo cáo khoa học: Crystal structure of the catalytic domain of DESC1, a new member of the type II transmembrane serine proteinase family pptx
... region of known TTSP structures Whereas in the stem regions of FEBS Journal 27 4 (20 07) 21 48 21 60 ª 20 07 Max-Planck-Insitute of Biochemistry Journal compilation ª 20 07 FEBS 21 55 Crystal structure of ... Koono M (1997) Analy- Crystal structure of the catalytic domain of DESC1 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 sis of tissue factor and tissue factor pathway inhibitor expression in human ... inhibited with benzamidine, concentrated to mgÆmL)1 and subjected to FEBS Journal 27 4 (20 07) 21 48 21 60 ª 20 07 Max-Planck-Insitute of Biochemistry Journal compilation ª 20 07 FEBS 21 57 Crystal structure...
- 13
- 588
- 0
Tài liệu Báo cáo khoa học: Crystal structure of the BcZBP, a zinc-binding protein from Bacillus cereus doc
... FEBS Journal 27 4 (20 07) 3044–3054 ª 20 07 The Authors Journal compilation ª 20 07 FEBS 3045 Crystal structure of BcZBP from B cereus V E Fadouloglou et al A B Fig Structure of the BcZBP dimer (A) ... Journal 27 4 (20 07) 3044–3054 ª 20 07 The Authors Journal compilation ª 20 07 FEBS 3047 Crystal structure of BcZBP from B cereus V E Fadouloglou et al Table Deacetylase activity of the BcZBP protein ... by bc1534 is classified as a LmbE-related protein and hereafter will be referred to as BcZBP (B cereus zinc-binding protein) The N-terminal part of BcZBP (residues 7– 124 ) belongs to the Pfam 025 85...
- 11
- 710
- 0
Tài liệu Báo cáo khoa học: ˚ The 1.8 A crystal structure of a proteinase K-like enzyme from a psychrotroph Serratia species docx
... the P2¢ residue, probably resulting from different scaffolds of the inhibitors Structures of PRK with inhibitors or sub- Fig Stereo plot illustrating inhibitor binding in subtilases The binding ... potential effect of the disulfide bridges will be discussed further below The region FEBS Journal 27 3 (20 06) 61–71 ª 20 05 The Authors Journal compilation ª 20 05 FEBS 63 Structure of proteinase K ... (CI2; PDB 1lw6, 1tm1 and 2sni [29 –31]) or eglinC (PDB 1sbn [ 32] ) and subtilisin Carlsberg in complex with eglinC (PDB 1cse [33]), ovomucoid turkey inhibitor (OMTKY3; PDB 1r0r [34]) or the double-headed...
- 11
- 551
- 0
Tài liệu Báo cáo khoa học: Crystal structure of a subtilisin-like serine proteinase from a psychrotrophic Vibrio species reveals structural aspects of cold adaptation docx
... resolution FEBS Journal 27 2 (20 05) 8 32 845 ª 20 05 FEBS ´ ´ J Arnorsdottir et al 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 Structural adaptations to cold and investgation of the active site J Biol ... 1SH7–1THM 28 1 27 9 26 1 (93%) 120 (43%) 0.84 27 9 27 9 23 8 (85%) 86 (31%) 1 .21 28 1 27 9 24 6 (88%) 93 (33%) 1.11 FEBS Journal 27 2 (20 05) 8 32 845 ª 20 05 FEBS regard to root mean square deviation, fraction of ... D188–K17 E28–K95 D 124 –K153 D188–R270 D201–R249 E253–R249 D257–R270 D257–K275 2. 97 3.00 3.91 2. 79 3 .20 2. 81 3.41 2. 98 2. 80 2. 78 ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A ˚ A a The criterion of conserved ion...
- 14
- 597
- 0
Tài liệu Báo cáo khoa học: Crystal structure of Trypanosoma cruzi glyceraldehyde-3-phosphate dehydrogenase complexed with an analogue of 1,3-bisphospho-D-glyceric acid Selective inhibition by structure-based design docx
... deviation of ± 4% T brucei T cruzi 20 00 20 00 350 800 65 20 00 150 900 20 0 700 HOP Inhibition and site-directed mutagenesis of T brucei gGAPDH In the absence of a 3D structure of a complex of T brucei ... substrate 1,3-BPGA We report here the refined crystal structure of a complex between the T cruzi gGAPDH and this substrate isosteric analogue On the basis of this crystal structure, we were able ... structural differences may be responsible for the extended/bent conformation of inhibitors inside the active site: (a) substitution of Ser247 in T cruzi gGAPDH by Ala246 in T brucei gGAPDH; (b) ...
- 13
- 588
- 0
Tài liệu Báo cáo khoa học: Crystal structure of thiamindiphosphate-dependent indolepyruvate decarboxylase from Enterobacter cloacae, an enzyme involved in the biosynthesis of the plant hormone indole-3-acetic acid doc
... site-directed mutagenesis study of L1 12, I4 72, I476, E473, and N4 82 Eur J Biochem 25 7, 538–546 Ó FEBS 20 03 3D structure of indolepyruvate decarboxylase (Eur J Biochem 27 0) 23 21 44 Bringer-Meyer, S., Schimz, ... 19 20 21 22 23 24 25 26 indole-3-acetic acid synthesis in Erwiniaherbicola Appl Environ Microbiol 62, 4 121 –4 128 Zimmer, W., Hundeshagen, B & Niederau, E (1994) Demonstration of the indolepyruvate ... substrate binding cavity in ZmPDC (Tyr290, Trp387 and Trp5 42) , are shown in red Ó FEBS 20 03 3D structure of indolepyruvate decarboxylase (Eur J Biochem 27 0) 23 19 Fig Comparison of the substrate binding...
- 10
- 557
- 0
Báo cáo khoa học: Crystal structure of salt-tolerant glutaminase from Micrococcus luteus K-3 in the presence and absence of its product L-glutamate and its activator Tris pdf
... coordinate by Luzzati (A) N BL-6A T AR-NW12A G AR-NW12A TG BL-6A 2. 3 10.9 (2. 2) 2. 5 11.0 (2. 1) 2. 6 9.1 (2. 8) 2. 4 8.7 (1.8) 189 811 52 671 100 (99.9) 149 20 7 40 451 98.4 (98.0) 125 111 35 920 98 .2 (99.6) ... 117.45 141. 62 75.15 90 104.0 90 58.0 118.36 141 .20 76. 12 90 105.4 90 41.0 F 19.9 2. 3 52 579 0 .24 7 0 .29 1 TG 19.9 2. 5 40 379 0 .21 7 0 .25 8 N 19.9 2. 6 35 873 0 .27 1 0.309 N 19.9 2. 4 46 741 0 .22 2 0 .26 8 118 ... [protein data bank (PDB) 3if5] [10], and glutaminases from E coli (PDB 1u60) [5], B subtilis (PDB 1mki, 3brm, 2osu) [5], Geobacillus kaustophilus (PDB 2pby) and human kidney (PDB 3czd) have been determined...
- 11
- 521
- 0
Báo cáo khoa học: The crystal structure of NlpI A prokaryotic tetratricopeptide repeat protein with a globular fold potx
... 24 0, 24 4 Helix 13 25 5, 25 8, 25 9 ,26 1, 26 2, 26 4, 26 6 16 Helix 14 27 1, 27 5, 27 8 2. 45 Total 38 FEBS Journal 27 2 (20 05) 166–179 ª 20 04 FEBS C G M Wilson et al Crystal structure of NlpI pendent domain ... 11 199 20 6 21 2 22 2 12. 9 7.4 +1 72. 6 )26 .0 40.4 (pair 5–6) GWNIVEFYLGNISEQTLMERLKADATD 12 13 22 6 24 6 25 0 26 1 19.4 8.6 (TPR4) )158.3 +38 .2 261 (pair 1–6) 14 26 9 28 3 7.9 – – – – a Defined by by PROCHECK ... interactions between elements of primary FEBS Journal 27 2 (20 05) 166–179 ª 20 04 FEBS structure, and include a hydrogen bond between the backbone carbonyl of Asn263 and the backbone amide of Leu34...
- 14
- 433
- 0
Báo cáo Y học: Crystal structure of the catalytic domain of a human thioredoxin-like protein pdf
... using BOBSCRIPT (44) (B) Backbone superpositions of the six structures of hTRXL-N and other thioredoxin related proteins or domains 1GH2 (crystal structure of hTRXL-N, 2 108), 2TRX (crystal structure ... (A) Bond angle (°) ˚ Average B- factor (A2) Protein atoms Solvent molecules ˚ 100 2. 2 A C2 a ¼ 87.5 b ¼ 48.5 c ¼ 29 .8 b ¼ 99.59 0.089 (0.316)a 6710 ( 624 )a 99.8 (98.7)a 8.4 ˚ 15 2. 2 A 22 .2 (6 026 ... images were generated using a combination of BOBSCRIPT [35], GRASP [36], RASTER 3D [37] and O [34] 20 62 J Jin et al (Eur J Biochem 26 9) Ó FEBS 20 02 Table Summary of crystallographic data collection...
- 9
- 533
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam nội dung cụ thể cho từng kĩ năng ở từng cấp độ phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 động cơ điện không đồng bộ một pha thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu chỉ tiêu chất lượng 9 tr 25