angle sum of a triangle activity

Ngày tải lên: 19/06/2014, 10:20

Ngày tải lên: 19/06/2014, 10:20

Ngày tải lên: 21/06/2014, 08:20

Ngày tải lên: 09/08/2014, 06:22

Ngày tải lên: 11/08/2014, 14:20

... aa 208 aa 24 aa BamH 34 aa Start Stop Xho1 N -Pro Protease domain Protease domain CT - ex 380 aa 1 II NP 114 aa 208 aa BamH1 34 aa Start Stop Xho1 SS SS G SSS S N-Pro 356 aa III MSTLFII S ILLFLAS F SYAMDI S TIEYKYDKSS AWRTDEEVKEIYELWLAKHDKVY SG LVEYEKRFEIFKDNLKFIDEH NSENHTYKMGLTPYTDLTNEEFQAIYLGTRSDTIHRLKRTINISERYAYEAGDNLPEQIDWRKKGAVTPVKNQGKCG SCWAFSTVSTVESINQIRTGNLISLSEQQLVDCNKKNHG CKGGAFVYAYQYIIDNGGIDTEANYPYKAVQGPCRAAK KVVRIDGYKGVPHCNENALKKAVASQPSVVAIDASSKQF QHYKSGIFSGPCGTKLNHGVVIVGYWKDYWIVRNSW GRYWGEQGYIRMKRVGGCGLCGIARLPYYPTKA AGDENSKLETPELLQWSEEAFPLA IV A B 66 ... the maximum activity using an azocasein assay at different tempera- tures, as described in Materials and methods. Each data point is an average of three independent experiments having similar values (Table ... 2011 The Authors Journal compilation ê 2011 FEBS cysteine proteases [Erv -A, -B and –C (isolated from the latex of Ervatamia coronaria in our laboratory) and papain from Carica papaya (Merck,...

Ngày tải lên: 14/02/2014, 14:20

... biological systems that utilise domain swapping to regulate activity. For example, glyoxylase I of Pseudumonas putida is a metastable domain-swapped dimer with two Zn 2+ cofactors that also exists as ... can be isolated by Cibacron Blue affin- ity chromatography. (A) Unusual behaviour of TorD on CibacronÔ Blue affinity media. A sample of 0.5 m M metal affinity chromatogra- phy-purified TorD was applied ... for GTPase activity, although this variant demonstrated enhanced XTPase activity (Fig. 6A, B). To test for an increased affinity for xanthine nucleotides by a different means, the standard malachite...

Ngày tải lên: 16/02/2014, 09:20

... mutations Mousumi Banerjee 1 , Hemalatha Balaram 2 and Padmanabhan Balaram 1 1 Molecular Biophysics Unit, Indian Institute of Science, Bangalore, India 2 Molecular Biology and Genetics Unit, Jawaharlal ... Ravindra G & Balaram P (2005) Plasmodium falciparum triosephosphate isomerase: new insights into an old enzyme. Pure Appl Chem 77, 281–289. 20 Parthasarathy S, Ravindra G, Balaram H, Balaram ... in enzymes: a study of triosephosphate isomerase and comparison with methyl glyoxalsynthase. Adv Protein Chem 66, 315–372. 45 Gunasekaran K, Ramakrishnan C & Balaram P (1996) Disallowed Ramachandran...

Ngày tải lên: 18/02/2014, 11:20

... abzymes; nitrosoalcanes; microperoxidase 8; S-oxidation. Catalytic antibodies with a metalloporphyrin cofactor, or ÔhemoabzymesÕ, are not as efficient a category of catalysts as their natural hemoprotein ... set of six monoclonal antibodies was thus obtained: the best peroxidase activity – that found with the complex of MP8 and one of those antibodies, 3A3 – was characterized by a k cat /K m value of 2 ... S-oxidation of thioanisole As the above results showed that the best system for the S-oxidation of thioanisole associated H 2 O 2 as an oxidant with MP8 as a catalyst in the presence of tBuOH as an organic...

Ngày tải lên: 19/02/2014, 12:20

... a positive or negative way. Muta- tional analysis has indicated residues that are important for selectivity and potency, and structural analyses of such mutants have suggested that what appear ... mutational analysis has been carried out on ImI, PnIA, PnIB and to a lesser extent on GID and MII. Analysis of ImI has revealed that Asp5-Pro6-Arg7 and Trp10 are important for biological activity ... 12 (Table 1) appears to contribute to a4 b2anda7 subtype activity but not a3 b2 activity. A decrease in a4 b2 and a7 subtype activity but not a3 b2 activity was observed in the [R1 2A] GID mutant [16]. An...

Ngày tải lên: 19/02/2014, 12:20

... take place at the N-terminal region of P40, as a bacterial signal peptide had been predicted [23–25]. Such signal peptides are normally cleaved off by a bacterial type I signal peptidase (SPase). ... of the gene product of MPN 142. Cleavage into P40 and P90 takes place after amino acid 454. The N-terminus of the mature P40 starts with amino acid 26. The molecular mass of about 36 000 Da of ... pathogenic bac- terium [1,2], characterized by a small genome of 816 kbp [3], the lack of a bacterial cell wall and a parasitic lifestyle [4]. Some species of the genus mycoplasma, e.g. Myco- plasma genitalium,...

Ngày tải lên: 19/02/2014, 18:20

... SDS/PAGE analysis. After 24 h, the fraction of molecules behaving as a substrate for uPA decreased approximately twofold for PAI-1(V12 6A) , PAI-1(F10 0A) , PAI-1(F12 8A) and PAI-1(W14 1A) with a concomitant increase ... half-life of PAI-1 was finally calculated from an exponential decay plot of the data obtained. Generally, only one preparation of each PAI-1 variant was investigated, but the following were investigated ... significantly faster latency transition rate and another component with a significantly slower latency transition rate. The activity of the three variants PAI-1 (N13 9A) , PAI-1(W14 1A) and PAI-1(T14 6A) ...

Ngày tải lên: 20/02/2014, 11:20

... i.e. agonistically as well as antagonistically, completely inactive. The lack of antagonistic activity may be explained by the fact that this lipid A does not intercalate into target cell membranes by ... in a membrane-bound form in which it is able to cause an intercalation of LPS into this membrane [41]. It can be assumed that membrane proteins such as CD14 may also cause a membrane intercalation ... Chicester. 32. Mu ă hlradt, P.F. & Frisch, M. (1994) Purification and partial bio- chemical characterization of a Mycoplasma fermentans-derived substance that activates macrophages to release nitric oxide, tumor...

Ngày tải lên: 21/02/2014, 00:20

... 5Â-CCATCCTAATACGACTCACTA TAGGGC-3Â) and a gene-specic sense primer (5Â-GCCG CTCGAGTTTGAGTTAGCCAGAAACTCC-3Â, XhoI site underlined) or antisense primer (5Â-ATAC GGGCCC GACAGTGGTGTGCCTGGGAAC-3Â, ... the results of Hasegawa et al. [13] who questioned the paraphyly of the order rodentia using the same data as Graur. In contrast, the distance matrix algorithms again placed the guinea pig together ... 11b- hydroxylase activity of CYP11B1 was strongly reduced (Fig. 5), whereas that of the aldosterone synthase was basically unaffected, while the 18-hydroxlase and oxidase activity was also greatly diminished....

Ngày tải lên: 22/02/2014, 07:20

... Chester, PA, USA). The percent- age of cell death and the standard deviation were calculated from three acquisitions of each treatment. The data are reported as percentage of BAMLET activity. Acknowledgements We ... the protein. Abbreviations a- LA, a- lactalbumin; BAMLET, bovine a- lactalbumin made lethal to tumor cells; CAC, critical aggregate concentration; HAMLET, human a- lactalbumin made lethal to tumor ... ovine and caprine a- LA [24]. The OA complex of bovine a- LA was named bovine a- LA made lethal to tumor cells (BAMLET) [21]. Moreover, it was also shown that a- LA mutants with amino acid replacements...

Ngày tải lên: 06/03/2014, 09:22

... transfection assays with increasing amounts of DNA fragments encoding cyt b 5 and monitored the formation of androstadienol and DHEA. As shown in Fig. 5 the stimulation of DHEA and androstadienol production ... activity reached a maximum at a ratio of 12 : 1. Thus, the influence of human cyt b 5 changes dramatically as the cyt b 5 /P450c17 ratio varies. Effect of P450red on DHEA and androstadienol synthesis To ... used as standards, showed elution peaks at 4.70, 2.30 and 2.50 min, respectively (Fig. 2). In both porcine and human assays using preg as a substrate, an additional peak of elution appeared at 15...

Ngày tải lên: 08/03/2014, 08:20

... Dickinson and Co.) was used to acquire and analyze data. A minimum of at least 10 000 cells was analyzed. Computation of specific constitutive activity (SCA) and relative SCA (RSCA) Given that the transfection ... Programma di Ricerca: Le malattie della tiroide: dalle basi molecolari alla clinica. Ministero dell’Universita ` e della Ricerca Scientifica (MURST), Programma di Ricerca: Strategie per la valutazione ... del Lavoro, Universita ` di Pisa, Pisa, Italy; 2 Dipartimento di Oncologia, Divisione di Anatomia Patologica, Universita ` di Pisa, Pisa, Italy; 3 Cattedra di Endocrinologia, Fondazione S Maugeri...

Ngày tải lên: 08/03/2014, 08:20

... numbering accord- ingly), and found to be 3748 nucleotides in length. A TATA-box (TATAA) was located at nucleotides 83–87 and a poly (A) sequence ATTAAA at nucleotides 2978–2983. A GC-rich area was 107 ... 3177–3182. 4 Okamoto H, Nishizawa T, Kato N, Ukita M, Ikeda H, Iizuka H, Miyakawa Y & Mayumi M (1998) Molecular cloning and characterization of a novel DNA virus (TTV) associated with posttransfusion ... Miyata H, Tsunoda H, Kazi A, Yamada A, Khan MA, Murakami J, Kamahora T, Shiraki K & Hino S (1999) Identification of a novel GC-rich 113-nucleotide region to complete the circular, single-stranded...

Ngày tải lên: 16/03/2014, 05:20

... both Arabidopsis ,a C 3 plant [9], and K. pinnata, a CAM plant (this study). Carbonic anhydrase is present in animals, plants, eubacteria and viruses [25]. S-glutathiolation of mam- malian carbonic ... Rubisco activity was measured [55] as soon as the extracts were prepared (initial activity) and after incubating them with saturating concentrations of CO 2 and Mg 2+ to carbamylate Rubisco (total activity) ... Borland AM, Haslam RP, Helliker BR, Roberts A & Griffiths H (1999) Modulation of Rubisco activity during the diurnal phases of the crassulacean acid metabolism plant Kalanchoe ă daigremontiana....

Ngày tải lên: 16/03/2014, 06:20

... INSERM, Paris. 12 Katayanagi K, Miyagawa M, Matsushima M, Ishikawa M, Kanaya S, Ikehara M, Matsuzaki T & Morikawa K (1990) Three-dimensional structure of ribonuclease H from E. coli. Nature ... Akasako A, Oobatake M, Itaya M & Kanaya S (1994) A novel strategy for stabilization of Escherichia coli ribonuclease HI involving a screen for an intragenic suppressor of carboxyl-terminal ... Sh-rnhB gene as a tem- plate, to the NdeI–SalI site of pET- 3a. The PCR primer sequences are 5Â-CTAGGATAAGCTT CATATGTCGACA TTATCGGTT-3Â for the 5Â-primer and 5Â-CGCGC GGA TCCAACGATAAACTCGCTTA-3Â for...

Ngày tải lên: 16/03/2014, 13:20