... analyze those games and understand what made them great Using classic games for inspiration is not only acceptable, it is essential What Types of Games Are Possible? Ultimately, the most successful ... games include first-person shooters such as Quake, space games such as Defender or Missile Command, maze games such as Pac-Man, and paddle games such as Pong • Combat Games—These games usually ... players hungry for good new games Advertising and Sponsorships Advertising and sponsorships are probably the easiest business models to implement, but the most difficult in which to achieve solid...
Ngày tải lên: 16/01/2014, 20:20
... with Moni and asked him about his business He explained that ever since his teens he was interested in clothes His mother had a small dressmaking business and when he finished school and went into ... classes; servants, workers, farm laborers and villagers living in squalor and iniquity With the nationalization of foreign companies and businesses and the departure of the foreign “colonies” ... approached and kissed him We were not accustomed to such displays of tenderness but his sadness at the airport touched me and I felt that he shared my sense of failure I asked how he was feeling and...
Ngày tải lên: 06/11/2012, 17:33
Báo cáo y học: "Peripheral blood but not synovial fluid natural killer T cells are biased towards a Th1-like phenotype in rheumatoid arthritis" pptx
... tissue samples As in PBMCs, the TCR Vα24 usage in SFMCs and synovial tissue tissue samples was skewed for some patients but polyclonal for others Again, the invariant TCR peak was detected in SFMCs ... individuals (2.3 ± 0.6 spots versus 24.3 ± 10.1 spots for IFN-γ and 0.2 ± 0.1 spots versus 3.9 ± 1.1 spots for IL-4 per × 105 cells for RA patients and healthy control individuals, respectively; ... (disease duration, disease status) or treatment and responsiveness/nonresponsiveness of NKT cells could be demonstrated Remarkably, synovial fluid NKT cells, even from nonrespondR497 Arthritis...
Ngày tải lên: 09/08/2014, 06:22
Báo cáo y học: "Genetic polymorphism of p53, but not GSTP1, is association with susceptibility to esophageal cancer risk – A Meta-Analysis"
... meta-analysis on 13 published case-control studies with 2919 cases and 4074 controls for p53 Arg72Pro and 1885 cases and 2194 controls for GSTP1 Ile105Val 301 Materials and Methods Identification and ... regression analysis, ref.[34] All analysis was done by using the Statistical Analysis System software (v.9.1.3, SAS Institute, Cary, NC) and Review Manage (v.4.2) All the P values were two-sided ... 105Val form shows altered affinity and enzymatic activity for some substrates.[37-39] However, our analysis results showed there was no significant relations between GSTP1 Ile105Val polymorphism and...
Ngày tải lên: 25/10/2012, 11:40
Báo cáo y học: "TPO, but not soluble-IL-6 receptor, levels increase after anagrelide treatment of thrombocythemia in chronic myeloproliferative disorders"
... affects TPO levels, we assessed the effects of months of anagrelide treatment of thrombocytosis in MPD patients on serum levels of TPO and the sIL-6 receptor The latter was chosen since some recent ... individuals Based on the studies by others, who used the same assay system as we have done [11, 23, 24], it appears that the starting TPO values for our MPD patients (mean values ± 2SD being 0-250 ... using the same assay as those investigators At this time no clear explanation for the discrepancies of results can be offered Material and Methods Patients 60 patients with a diagnosis of myeloproliferative...
Ngày tải lên: 03/11/2012, 10:52
Tài liệu Báo cáo khoa học:Tyrosine phosphorylation of tau regulates its interactions with Fyn SH2 domains, but not SH3 domains, altering the cellular localization of tau ppt
... expression of GST have been described previously [21] Plasmids expressing Fyn-SH3 and Fyn-SH2 were obtained from S Anderson (University of Colorado Health Sciences Center, Denver, CO, USA) GST–Fyn-SH2 ... cDNA; S Anderson (University of Colorado Health Sciences Center) for pGEX constructs; and D Markby (Sugen, San Francisco, CA, USA) for human Fyn cDNA This work was supported by Alzheimer s Research ... Preparation of GST fusion proteins and GST pulldown Isolation of DRMs Generation of GST, GST–Fyn-SH2 and GST–Fyn-SH3 and subsequent coupling to glutathione beads have been described previously [21]...
Ngày tải lên: 14/02/2014, 14:20
Tài liệu Báo cáo khoa học: Dual P2Y12 receptor signaling in thrombin-stimulated platelets – involvement of phosphoinositide 3-kinase b but not c isoform in Ca2+ mobilization and procoagulant activity pdf
... Statistical analysis Statistical analysis was performed with Student s t-test, using the Statistical Package for Social Sciences, version 11.0 (SPSS Inc., Chicago, IL, USA) Data are presented as ... buffers and (ant)agonists Measurement of cytosolic cAMP and InsP3 Intracellular levels of cAMP and InsP3 in resting and activated platelets were measured as described previously [27] Basal concentrations ... [46] SERCA activity represented the ATP- and thapsigargin-sensitive phosphatase activity Measurement of Akt activation Akt activation was measured by western blot analysis, using a phosphoserine-473...
Ngày tải lên: 18/02/2014, 16:20
Tài liệu Báo cáo khoa học: Activated Rac1, but not the tumorigenic variant Rac1b, is ubiquitinated on Lys 147 through a JNK-regulated process docx
... Romain Gautier for the pictures of GTPase structures, and Anne Doye for technical assistance This work was supported by grants ´ from INSERM, CNRS, Universite Paris Descartes, and Association pour ... structures of Ypt7 and Rac1 are compared (supplementary Fig S4 ), Lys147 has closely similar spatial situations; this observation raises the hypothesis that similar mechanisms and homologous E3 ubiquitin ... of and degradation by the 2 6S proteasome [18], and Lys63-linked chains regulate processes such as signal transduction and DNA repair through proteasome-independent mechanisms, whereas much less...
Ngày tải lên: 18/02/2014, 16:20
Cytoskeleton reorganization mediates alpha beta integrin-associated actions of laminin on proliferation and survival, but not on steroidogenesis of ovine granulosa cells pdf
... were fitted to sigmoidal dose – response curves or Gaussian distributions with GraphPrad PRISM software (San Diego, CA, USA) The effects of increasing doses of inhibitors (cytochalasin D or PD98059) ... cells and the amount of estradiol or progesterone secreted by GC from large follicles (Fig 8c) These results support the existence of uncoupling of GC shape and steroidogenesis and suggest that ... shape on steroidogenesis Biol Reprod 1988, 38(4):881-890 Silavin SL, Javitt NB, Strauss JF: Reevaluation of the effects of cytochalasins on steroidogenesis: studies on hamster granulosa cells Endocrinology...
Ngày tải lên: 05/03/2014, 17:20
Blackwell Science, Ltd Group breeding dramatically increases reproductive success of yearling but not older female scrubwrens: a model for cooperatively breeding birds? ppt
... a season while others did well, so it was not appropriate to use ‘nests’ as the unit of analysis In this case the proportion of nests that were successful was modelled, using number of successful ... ecology and behavior (eds P.B Stacey & W.D Koenig), pp 593 – 611 Cambridge University Press, Cambridge SPSS Inc (1999a) SPSS 9.0 Base Syntax Reference Guide SPSS Inc., Chicago SPSS Inc (1999b) SPSS ... pairs This result suggests that group size has a greater effect on reproductive success in species in which food is more likely to be scarce However, Hatchwell emphasizes that his study was designed...
Ngày tải lên: 14/03/2014, 16:20
Dangerous But Not Omnipotent pptx
... increased multilateral pressure against its nuclear ambitions The analyses that informed these conclusions also yielded the following insights for U .S planners and strategists concerning Iran s strategic ... region and to use force to protect its interests and those of its allies against threats from both state and non-state actors These statements would underscore that U .S military postures are for ... on the “usual suspects”—clerical dissidents, intellectuals, students, and journalists.40 What has reportedly taken many by surprise is the pervasive and widening circle of repression since early...
Ngày tải lên: 15/03/2014, 21:20
Báo cáo khoa học: Protein crystallography for non-crystallographers, or how to get the best (but not more) from published macromolecular structures potx
... cases the readers will not be expected to repeat structure refinement and map analysis themselves It is very important to apply some common-sense tests before taking structural results as an absolute ... atoms and groups, with anisotropically refined Fe and S atoms, and with no record of geometry indicators such as rmsd(bond) given in the PDB file This structure and ones like it should also raise significant ... structure quality based on the contents of PDB file headers is not easy for non-crystallographers, yet we must stress that any user of such information should look at the header first, before spending...
Ngày tải lên: 16/03/2014, 06:20
Báo cáo khoa học: H2O2, but not menadione, provokes a decrease in the ATP and an increase in the inosine levels in Saccharomyces cerevisiae An experimental and theoretical approach pot
... Oxidative stress responses of the yeast Saccharomyces cerevisiae Yeast 14, 15111527 17 Costa, V & Moradas-Ferreira, P (2001) Oxidative stress and signal transduction in Saccharomyces cerevisiae: insights ... cerevisiae has been used as model system to explore the mechanisms underlying the oxidative stress response, such as exposure to H2O2 or menadione [1619] In this study we have assessed the effect ... relative rates of both processes could affect the actual concentration of ATP and hence the rate of synthesis of inosine It is here assumed that the complex processes of syntheses and degradation...
Ngày tải lên: 17/03/2014, 10:20
Báo cáo Y học: Ruk is ubiquitinated but not degraded by the proteasome ppt
... longest isoform of Ruk (Ruk L) exhibits the strongest association with endogenous and exogenously expressed Cbl The association of Ruk M and Ruk S with c-Cbl was quite unexpected, as these isoforms ... Kinase or its downstream effector PKB/Akt [11] In agreement with these findings, overexpression of SETA was shown to trigger apoptosis in astrocytes [13] Specific associations between SETA and ... recognizes all three isoforms As shown in Fig 3A, untagged Ruk L specifically coimmunoprecipitates with all three EE-tagged isoforms The expression of EE-tagged Ruk isoforms in transfected cells was...
Ngày tải lên: 17/03/2014, 23:20
Báo cáo khoa học: Amyloid structure – one but not the same: the many levels of fibrillar polymorphism potx
... highest possible quality of glucagon samples We are also grateful to Drs Christian Rischel, Peter Westh and James Flink for fruitful collaborations and stimulating discussions JSP is supported ... these species appears to surpass that of mature fibrils [76] It is possible that the toxicity of aggregates is simply correlated directly with the surface to mass ratio, implying that smaller structures, ... of glucagon, histidine residue (His1), the three aspartic acid residues (Asp9, Asp15 and Asp21) and the C-terminus exist mostly in the protonated state This means that glucagon has a net charge...
Ngày tải lên: 23/03/2014, 03:20
Báo cáo khoa học: Insulin is a kinetic but not a thermodynamic inhibitor of amylin aggregation pot
... microscope (JEOL) at 100 kV SEC assay To examine the contents of sample solutions, an SEC (TSKG3000PWxl; Tosoh, Tokyo, Japan) assay was performed on an HPLC system (Waters 600; Waters, Milford, ... (Fig 5E) also showed the presence of insulin in amyloid fibrils It has been reported that insulin can exist as monomers, dimers and hexamers in solution [18,19] As shown in Fig 6, it seems that the ... scattering assays and HPLC analysis at selected time points ThT assay To monitor peptide fibrillation, a ThT assay was performed at selected time points by combining 20 lL of sample solution with...
Ngày tải lên: 23/03/2014, 04:21
Báo cáo khoa học: Novel isoenzyme of 2-oxoglutarate dehydrogenase is identified in brain, but not in heart potx
... -AVIQESRASVSSCTKTSKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSF RNTNAGAPPGTAYQSPLSLSRSSLATMAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSS RNTNAGAPPGTAYQSPLSLSRSSLATMAHAQSLVEAQPNVDKLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSS ... MS analysis provides strong advantages over immunological approaches to address this challenge, because determination of isoform-specific peptides distinguishes unambiguously between isoforms ... cleavage system in the high molecular mass fraction comprising the pyruvate and 2-oxoglutarate dehydrogenase complexes was expected, as this complex is much smaller and dissociates easily into its components...
Ngày tải lên: 23/03/2014, 06:20
Báo cáo khoa học: The activation of gelsolin by low pH The calcium latch is sensitive to calcium but not pH docx
... and G6 [5,22] We propose that low pH sets off a similar but distinct set of ionpair exchanges, presumably initiated at histidine residues, that also disrupts interdomain bonds but not those formed ... ELISA that the binding of gelsolin to G-actin was similar for various actin iso-forms [rabbit alpha skeletal, bovine alpha cardiac, bovine aortic and scallop (Pecten) muscles], and established ... to tryptophan emission (j) or Oregon green emission (h) is plotted vs pH (B) The maximum wavelength of tryptophan fluorescence emission is plotted vs pH Kd is less for the last condition (Kd ¼...
Ngày tải lên: 23/03/2014, 21:20
Social capital and Health status: a protective impact among elderly or inactive but not among active ? doc
... latter is used in our study To assess individual health status, we use the first of three standardised questions suggested by the WHO European Office relative to self-assessed health This indicator ... participation and self-assessed health status Since the correlation that we may expect between social capital and self-assessed health status should not be considered as causality, we secondly attempt ... self-assessed health status while 50.7% of the “inactive” one reports the same self-assessed health status This result is not a surprise and may be seen as the result of the population break down since...
Ngày tải lên: 28/03/2014, 20:20