... in England T e Sydney Opera House was designed by T ralian architect een Elizabeth II came to Sydney in 1973 The Eiffel Tower is the world’s second st visited tourist place The Temple of Literature ... Merlion Temple of Literature Eiffel Tower English Unit Cities of the world Vocabulary Matching Read about landmark Can you guess which landmark from they are? English Unit Cities of ... English Unit Cities of the world Vocabulary - design(v)thiết - symbolkế (n)biểu -tợng landmark- (n)vùng đất - UNECO world Heritage – (n) di s¶n thÕ giíi - creature – (n) sinh vËt g: Sydney
Ngày tải lên: 18/04/2020, 21:37
... collections Colour and characters of peduncles and seeds in the processing of their development were observed, described and illustrated by photos in details Keywords: Podocarpus s.str., revised specimens ... study is to enumerate taxa of the Podocarpus s str Methods of classical external morphology study are applied 46 historical collecting numbers and new collecting numbers were studied, revisedand ... Ridgway, Piccadilly, London, 1818, p 170 [5] Don D. , Description of the genus Pinus: Illustrated with figures, directions relative to the cultivation, and remarks on the uses of the several species
Ngày tải lên: 18/03/2021, 10:39
Study of the morphology of the low latitude d region ionosphere using the method of tweeks observed at buon ma thuot, dak lak
... purpose of the sampling of the sound card’s ADC The ELF/VLF signals from East - West channel of preamplifier are sent to the soundcard SpectrumLab software records the broadband ELF/VLF signals with ... present the polarized wave The curves on the left side of the electric field lines represent the variations in the vertical electric field (E V ) and horizontal electric field (E H ) strengths The theory ... (Helliwell, 1965) Tweeks propagate by multiple modes such as the zero-order mode, the first-order mode, the second-order mode and so on The mode means the number of field patterns in the plane of
Ngày tải lên: 14/10/2022, 13:35
complete nucleotide sequence of the cryptomeria japonica d don chloroplast genome and comparative chloroplast genomics diversified genomic structure of coniferous species
... Selaginella [36-41] Doyle et al [38] postulated the functional transfer of rps16 from the chloroplast to the nucleus in order to explain the absence of this gene in such a large number of unrelated ... -MVKLRLKRCGRKQLATYRIVAINVESRREGKALQEVGFYDPMK-DQTYSNVPAILHFLEKGAQPTETVHDILEKAGIFKKFQTNLMVKLRPKQCGRKQ-RTYRIVAIESQSRQEGKVIKEVEFYNPRR-EETQLDILAITTLCGSGVKLTETVCNIFRRATFKIT -MVKLRLKRCGRKQ-PVYRIVAIDVRSRREGRDLRKVGFYDPIN-NQTYLNIPAILFFLEKGAQPTGTVYDILKKAGVS ... that of other land plants, including pine species, in terms of genome size and gene order as well as in the absence of the large IRs Thus, the complete cp genome sequence of C japonica would drastically
Ngày tải lên: 01/11/2022, 09:10
expression of the na l symporter nis is markedly decreased or absent in gastric cancer and intestinal metaplastic mucosa of barrett esophagus
... in the parietal and chief cells, or in the neuroendocrine cells Similarly, the goblet, Paneth, and ciliated epithelial cells of gastric intestinal metaplasia, as well as the mucus-producing columnar ... and lactationally regulated mammary gland NIS, both salivary and gastric NIS are constitutively expressed[6,25,26] NIS has been detected in the basolateral membrane of all ductal epithelial cells ... revealed very distinctly in http://www.biomedcentral.com/1471-2407/7/5 which particular cells NIS is located in each tissue, namely the thyroid epithelial (Fig 1C ,D) , salivary gland ductal epithelial
Ngày tải lên: 02/11/2022, 10:44
look at the picture answer what they are choose the first letter of the words to make a new word kính chào các thầy giáo cô giáo về dự giờ thứ 4 ngày 21 tháng 10 năm 2009 giáo viên nguyễn thị hồng l
... about the student in the picture a Work with a partner Ask and answer questions about the student in the picture A What are they doing? B They are playing catch A What is boy doing? B He is playing ... Period 29: B1,B2 It’s time for recess recess recess skip rope skip rope play c atch play c atch play ma rbles play ma rbles Play b lindm an’s b luff Play b lindm an’s b luff ... (v): chơi bi Play blindman’s bluff (v): bịt mắt bắt d? ? I Activities at recess I Activities at recess * New words (14)Unit 5: WORK AND PLAY Unit 5: WORK AND PLAY Period 29: B1,B2 It’s
Ngày tải lên: 16/04/2021, 08:34
Guy Fawkes or A Complete History Of The Gunpowder Treason, A.D. 1605 pot
... readable by the widest variety of computers including obsolete, old, middle-aged and new computers It exists because of the efforts of hundreds of volunteers and donations from people in all walks ... prince, and all the lords spiritual and temporal, and commons, should have been assembled in the Upper House of Parliament upon the Fifth day of November, in the year of our Lord 1605, suddenly to ... slanderously call cruel laws, enacted against them and their religion, both place and person should be all destroyed and blown up at once, which would have turned to the utter ruin of this whole kingdom,
Ngày tải lên: 08/03/2014, 22:20
Báo cáo khoa học: Structural basis for the erythro-stereospecificity of the L-arginine oxygenase VioC in viomycin biosynthesis docx
... and one b-strand (A) parallel to the first b-strand, B, of the jelly roll core. The linkage of the fourth (E) and fifth (F) b-strand of the jelly roll fold is built up by an extended insert (Val199–Leu296) consisting ... complex VioC? ?L- arginine•tar- trate•Fe(II). The b-strands B, G, D, I and C build the major side of the jelly roll fold, and the minor side is built by the b-strands F, E and H. The flexible lid region ... the loop linking b-strands C and D (His168 and Glu170) and on b-strand H (His316), indicating that the iron- binding facial triad is located near the minor sheet of the jelly roll fold. Instead of
Ngày tải lên: 16/03/2014, 02:20
Báo cáo khoa học: Characterization of the bga1-encoded glycoside hydrolase family 35 b-galactosidase of Hypocrea jecorina with galacto-b-D-galactanase activity pdf
... aryl- and alkyl-b -d- galactosides. Based on the catalytic efficiencies, lactitol and lactobionic acid are the poorest substrates and o-nitrophenyl-b -d- galacto- side and lactulose are the best. The ... catalyses the hydrolysis of terminal nonreducing b -d- galactose residues in b -d- galactosides as, for example, lactose (1,4-O-b -d- galactopyranosyl -d- glucose) and structur- ally related compounds. It ... observed in the double- and triple-charged mole- cules at the high mass side of the peaks (indicated by asterisks in Fig. 2A). Capillary gel electrophoresis- on -the- chip confirmed that the isolated
Ngày tải lên: 16/03/2014, 11:20
Báo cáo khóa học: Assembly of the silk fibroin elementary unit in endoplasmic reticulum and a role of L-chain for protection of a1,2-mannose residues in N-linked oligosaccharide chains of fibrohexamerin/P25 ppt
... synthesized in the posterior silk gland (PSG) cells, secreted into the lumen of PSG, associated with sericin in the lumen of the middle silk gland (MSG) and spun out from the anterior silk gland ... samples from cocoon shells of the normal breed, Nd-sD mutant and two transgenic lines Proteins from cocoon shells of a normal breed C108 (C; lanes and 5), Nd-sD (ND; lanes and 6), L6 · (L6 ; lanes ... Enzymology, Department of Molecular and Cell Biology, Graduate School of Agricultural Science, Tohoku University, Sendai; 5Department of Agricultural and Biological Chemistry, College of Bioresource
Ngày tải lên: 16/03/2014, 16:20
Báo cáo khoa học: Characterization of D-amino-acid-containing excitatory conotoxins and redefinition of the I-conotoxin superfamily pot
... muscle in the trough, the muscle was denervated and stretched over all four wells, with one end pinned in well and the other end in well Segments of muscle in wells and were kept submerged by ... variants of the toxins were folded in the presence of reduced and oxidized glutathione with a yield of 70%, and purified to homogeneity by RP-HPLC The identities of the peptides were confirmed by MALDI ... electrode was located in the middle, and the other at one end, of the trough Each pair of recording electrodes was connected to a differential A ⁄ C amplifier, and the signal bandpass-filtered (1 Hz
Ngày tải lên: 16/03/2014, 22:20
Tess of the d'urbervilles
... Angel studied at the mil! nearby The day, the impossible day of their wedding, came closer His wife, Tess said to herself Could it ever be? Angel and Tess decided to spend a day together ... jealous of each other They had even heard that Angel's family... flour-mill They could spend their honeymoon staying in the old farmhouse which had once belonged to the d' Urbervilles, while ... horses pulled it slowly along the field Its arms turned, bright in the sunlight... a view of Blackmoor Vale, which she knew so well There the sky was deep blue, the smell of the earth
Ngày tải lên: 20/03/2014, 16:19
Báo cáo khoa học: Total chemical synthesis and NMR characterization of the glycopeptide tx5a, a heavily post-translationally modified conotoxin, reveals that the glycan structure is a-D-Gal-(1fi3)-a-D-GalNAc pot
... trifluoroacetic acid and immediately injected onto RP-HPLC and fractions collected were collected and analyzed with ESI and MALDI-MS Chemical reduction The native and synthetic tx5a (hydrophilic and hydrophobic) ... bridge-containing glycopeptides the yield is dramatically affected by the scale of the reaction, the excess of amino acids used, and the level of purity desired Here, our reaction scale was limited by the costs ... Chemically reduced hydrophilic tx5a Chemically reduced Native tx5a with data collected previously in 90 : 10 H2O /D2 O enabled assignment of the amino acid and sugar spin systems of the glycopeptide
Ngày tải lên: 23/03/2014, 13:20
Tài liệu Báo cáo khoa học: Isoprenoid biosynthesis via the methylerythritol phosphate pathway Mechanistic investigations of the 1-deoxy-D-xylulose 5-phosphate reductoisomerase ppt
... retroaldolization/aldolization would both afford the same reaction product MATERIALS AND METHODS General methods Unlabelled DXP was prepared either enzymatically [32], or chemically (Hoeffler et al., unpublished ... yield Addition of methyl lithium gave a lactol, which opened under standard phosphorylation condition to the enantiomerically pure ketone 17, but with low yield [37] Deprotection of the silyl ether ... silyl ether, gave diol 22 in excellent yield Selective phosphorylation of the primary alcohol of 22 with dibenzylphosphate chloride [37] at low temperature followed by oxidative cleavage [38] of...
Ngày tải lên: 21/02/2014, 03:20
An investigation into the pronunciation of the fricatives θ and ð experienced by the students of grade 10th at thanh binh 2 high school – problems and solutions
... about literature review, chapter the methodology of the study, and chapter the results and discussion The last one is the conclusion of the study consisting of overview of the study, limitations of ... place of articulation, manner of articulation, and degree of noise in the following table below Table 1.2 English fricatives Degree of noise Place of articulation Labiodentals Dental voiceless ... Also asthma, etc thence, thither Exceptions Final *Verbs ending in a dental fricative usually have /ð/, and are frequently spelled the : bathe, breathe, clothe, loathe, scathe, scythe, seethe,...
Ngày tải lên: 27/07/2014, 02:01
Báo cáo khoa học: Identification and characterization of the metal ion-dependent L-alanoyl-D-glutamate peptidase encoded by bacteriophage T5 pdf
... cells but did not lyse them (the attenuance of the cell mixture did not decrease) At the same time, endolysin with polymyxin B lysed the cells completely The nontreated and endolysin-treated ... respectively Table Content of Glu relative to Ala in the samples of enzymatically hydrolyzed peptidoglycan of Ps putida The contents of individual amino acids were determined after acidic hydrolysis of ... subtilis cells were lysed relatively well; however, the rate of their lysis was about 104-fold lower than that of Gram-negative cells In Listeria cells, the rate of lysis was an order of magnitude...
Ngày tải lên: 30/03/2014, 02:20
THE I N D I V I S I B L E WHOLE
... And down across New Orleans and then looking down to the south and there's the whole peninsula of Florida laid out And all the hundreds of hours you spent flying across that route, down in the ... through well-intentioned programs such as building new houses for disadvantaged urban dwellers, will generally improve matters only in the short run and often lead to still more problems in the long ... control of the oil in their lands, Shell's position was enhanced It enjoyed an edge that has enabled it to come close to [its founder] Deterding's goal: eclipse Exxon as the world's largest oil...
Ngày tải lên: 17/10/2013, 18:20
Picture of the victorian society in the two novels oliver twist and vanity fair = bức tranh xã hội anh thời kì victoria qua hai tác phẩm ôlivơ tuyxt và hội chợ phù hoa
... moral degeneration 3.2.1 The luxurious life of the upper and the middles class Leaving the world of “Oliver Twist”- the grim world of the poor, which was full of the devastating scenes and was ... skillfully used these typical images as the symbols of all the poignant cries of the starved and unloved in the brutal world Unable to bear such an awful living conditions, many children died in ... in the dark corner of the workhouses Other escaped to London and established a criminal underclass These children much rather stole and were punished than slaved in the bad conditions of the workhouses...
Ngày tải lên: 19/12/2013, 14:05
Tài liệu Engineering Mechanics - StaticsChapter 1Problem 1-1 Represent each of the following combinations of units in the correct SI form using an appropriate prefix: (a) m/ms (b) μkm (c) ks/mg (d) km⋅ μN Units Used: μN = 10−6N kmμkm = 109−6Gs = 10 s pptx
... 2-18 If the tension in the cable is F1, determine the magnitude and direction of the resultant force acting on the pulley This angle defines the same angle θ of line AB on the tailboard block Given: ... = 25 lb F = 50 lb θ = 30 deg 18 © 2007 R C Hibbeler Published by Pearson Education, Inc., Upper Saddle River, NJ All rights reserved This material is protected under all copyright laws as they ... Hibbeler Published by Pearson Education, Inc., Upper Saddle River, NJ All rights reserved This material is protected under all copyright laws as they currently exist No portion of this material...
Ngày tải lên: 17/02/2014, 14:20
Tài liệu Báo cáo khoa học: Structural and functional specificities of PDGF-C and PDGF-D, the novel members of the platelet-derived growth factors family docx
... while PDGF-C and -D mRNA levels changed dramatically [84] Concomitantly, the level of phosphorylated PDGFR-a was markedly upregulated in bleomycin-treated lungs PDGF-C mRNA could not be detected ... expression allowing binding of some PDGFs but not others Additionally, some cells display only one of the PDGFR isoforms while other cells express both isoforms, simultaneously or separately Third, different ... parietal glomerular cells but not in the glomerular tuft In the tubulointerstitium, PDGF-C is located in collecting ducts and the loop of Henle [81] PDGF-C protein localization in adult rodent kidneys...
Ngày tải lên: 19/02/2014, 07:20