... The Arabian Nights, also called A Thousand and One Nights, is a collection of stories, fairy tales, and fables gathered from Arabian and Indian folklore and passed down orally Nearly 0 stories ... teaching, and scholarship Let 's start with service The 1RS An award committee Dr Wilma Wacca Teachers In Japan, gourmets relish aquatic fly larvae sautéed in sugar and soy sauce Venezuelans feast on ... business communication Study their form as well as content Good writers are avid readers "Read, read, read Just like a carpenter who works as an apprentice and studies the master Read!" said...
Ngày tải lên: 01/11/2013, 16:20
... place to another man It is a case of suicide as a duty There are instances when a husband should know that it is his duty to disappear Jacques is "a stoic." George Sand has a great admiration ... legal advisor 39 George Sand was an admirable nurse This must certainly be acknowledged She sat up with him at night and she nursed him by day, and, astonishing woman that she was, she was also ... thought it must be a burglar She was most sarcastic about Aurore 's "fine education" and her literary aspirations Her hatred of the dead grandmother was as strong as ever She was constantly insulting...
Ngày tải lên: 06/03/2014, 23:21
The important role of newspaper andmagazines in our lives ppt
... Firstly, newspapers and magazines supply us with a variety of news every day They keep us informed of the political situation of the world By reading newspapers and magazines we can know what is ... against social evils such as theft, murder, robbery, rape, gambling and smuggling Fifthly, we can improve our English language by reading newspapers and magazines written in English This enables ... the advertising page, a missing relative in the finding missing relative column and condolence news in the agony column Fourthly, the Police Newspapers and Magazines help us take precautious against...
Ngày tải lên: 22/07/2014, 04:20
Báo cáo khoa học: "Hepatic splenosis mimicking HCC in a patient with hepatitis C liver cirrhosis and mildly raised alpha feto protein; the important role of explorative laparoscopy" potx
... diagnosis of hepatic splenosis can have a significant negative impact on patient 's management [15] Interestingly, in all cases a history of post-traumatic splenectomy was reported and all patients ... demonstrating a solitary cm hypervascuArterial (A) segment venous phase Arterial (A) and portal venous phase (B) of IV Gadlinium enhanced axial MRI images demonstrating a solitary cm hypervascular ... this patient 's management, avoiding unneccassary laparotomy or'/and surgical resection in a high-risk patient Hepatic splenosis is not a rare event and should be suspected in patients with a history...
Ngày tải lên: 09/08/2014, 04:20
A study on the translation of english important diplomatic terms in diplomacy documents
... Vietnamese: S đồng thuận Ambassadress A term often used to denote the wife of an ambassador, and misused to denote a woman chief of mission The latter is an ambassador, not an ambassadress In ... indicates serious displeasure but stops short of an actual diplomatic break is for a government to recall its ambassador indefinitely This is preferable to a break in relations as his embassy will ... power to an ambassador s normal job Ambassador is capitalized when referring to a specific person (i.e Ambassador Smith) In Vietnamese: Đại s đặc mệnh to n quyền Ambassador-Designate An official...
Ngày tải lên: 11/12/2013, 23:55
Tài liệu Stuff - The OSI Model pptx
... Translates data messages from upper layers to frames, enabling hardware to transmit upper layer messages as a bit stream Provides flow control to the layer Also carries a Frame Check Sequence to ... establishment, data transfer and connection release Responsible for end -to- end integrity of data transmission • • • • Segments data and also reassembles data from upper layers Delivers data ... • Manages data presentation conversions e.g., Converting from EBCDIC to ASCII Data encryption, decryption, compression and decompression Does this by using Abstract Syntax Notation (ASN.1) ASN.1...
Ngày tải lên: 24/01/2014, 09:20
Tài liệu The US Organic Industry: Important Trends and Emerging Issues for the USDA ppt
... Producers, Agribusinesses, Researchers and Students USDA-Cooperative State Research, Education and Extension Service (CSREES) http://csrees.usda.gov/, 202-401-4879 CSREES addresses organic agriculture ... increasingly emphasizes issues such as environmental sustainability, nutritional and social impacts, organic agriculture provides a readily identifiable segment of products and processes that strives ... integrate organic production, marketing and financial performance questions Natural Resources Conservation Service o Financial assistance for transition and certification Risk Management Agency, and...
Ngày tải lên: 14/02/2014, 03:20
Tài liệu Báo cáo Y học: The b-1,4-endogalactanase A gene from Aspergillus niger is specifically induced on arabinose and galacturonic acid and plays an important role in the degradation of pectic hairy regions pdf
... sodium hydroxide for 40 D-galactose, D-galactobiose and D-galactotetraose were used as standards to identify the D-galactose and D-galacto-oligosaccharides The calculated areas for D-galactose ... predominantly linear Potato arabinogalactan consists of 86% D-galactose and 6.6% L-arabinose, while soy arabinogalactan consists of 57% D-galactose and 38% L-arabinose Methylation analysis demonstrated ... demonstrated that a substantial amount of the L-arabinose residues (14%) in soy arabinogalactan is present as terminal residues [21], suggesting that of these arabinogalactans, soy arabinogalactan is the...
Ngày tải lên: 21/02/2014, 01:21
Tài liệu Báo cáo khoa học: The molecular surface of proteolytic enzymes has an important role in stability of the enzymatic activity in extraordinary environments pptx
... KAVSSGIVVAAAAGNEGSSGSTSTVGYPAKYPSTIAVGAVNSSNQRASFSSAGSELDVMAPGVSIQSTLP KAVSSGIVVAAAAGNEGSSGSSSTVGYPAKYPSTIAVGAVNSSNQRASFSSAGSELDVMAPGVSIQSTLP KAVSSGIVVAAAAGNEGSSGSSSTVGYPAKYPSTIAVGAVNSSVQRASFSSAGSELDVMAPGVSIQSTLP KAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLP ... KAYASGIVVVAAAGNSGSSGSQNTIGYPAKYDSVIAVGAVDSNKNRASFSSVGAELEVMAPGVSVYSTYP KAVSSGIVVAAAAGNEGSSGSTSTVGYPAKYPSTIAVGAVNSSNQRASFSSVGSELDVMAPGVSIQSTLP KAVSSGIVVAAAAGNEGSSGSTSTVGYPAKYPSTIAVGAVNSSNQRASFSSAGSELDVMAPGVSIQSTLP ... 210 SATSRGVLVVAASGNSGA-GSIS -YPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYP SATSRGVLVVAASGNSGA-GSIS -YPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYP SATSRGVLVVAASGNSGA-GSIS -YPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYP...
Ngày tải lên: 21/02/2014, 03:20
Tài liệu Báo cáo Y học: The insert within the catalytic domain of tripeptidyl-peptidase II is important for the formation of the active complex potx
... catalytic Asp44 and His264 are indicated by asterisks to activate the material, as previously described [15] However, all attempts so far to associate this material have failed Thus, it appears ... column and chromatography was performed as described in Materials and methods Enzyme activity was analysed by the standard assay and the immunoreactivity was detected by Western blot analysis and ... hitherto sequenced variants of TPP II (i.e rat, mouse, fruit fly, Arabidopsis thaliana, Caenorhabditis elegans and Schizosaccharomyces pombe), and at least three human EST-clones covering this area...
Ngày tải lên: 21/02/2014, 15:20
Global systemically important banks: assessment methodology and the additional loss absorbency requirement docx
... the sample total for cross-jurisdictional claims and liabilities, as opposed to a bank s own total assets and liabilities Global systemically important banks: Assessment methodology and the additional ... using observable measures, such as market prices or models Level assets are illiquid, and fair values can only be calculated using estimates or risk-adjusted value ranges This classification system ... the amounts of their intra -financial system assets (liabilities) divided by the sum total intra -financial system assets (liabilities) of all banks in the sample 11 See Basel Committee, Basel...
Ngày tải lên: 06/03/2014, 09:20
Báo cáo khoa học: N-Glycosylation is important for the correct intracellular localization of HFE and its ability to decrease cell surface transferrin binding pptx
... Tunicamycin treatment results in a reticular pattern of HFE localization Previous studies have demonstrated that HFE undergoes post-translational N-glycosylation As a first step towards assessing ... Another example is the type transferrin receptor, which has N-glycosylation sites at residues Asn251, Asn317 and Asn727 Mutation of Asn727 decreases cell-surface expression, whereas mutation at the ... Mutagenesis protocol (Stratagene, Agilent Technologies, Dublin, Ireland) To generate the pEP7–HFE-N11 0A HA vector we used the following primer set: sense, ATGGAAAATC ACGCCCACAGCAAGGAG; antisense,...
Ngày tải lên: 06/03/2014, 22:21
Báo cáo khoa học: The N-terminal hybrid binding domain of RNase HI from Thermotoga maritima is important for substrate binding and Mg2+-dependent activity pot
... prepared by hybridizing lm of the 5¢-FAM-labeled 12 base RNA (5¢-cggagaugacgg-3¢), 29 base DNA13-RNA4(5¢-AATAGAGAAAAAGaaaaAAGATGGCAA DNA12 AG-3¢), 29 base DNA15-RNA1-DNA13 (5¢-AATAGAGAA AAAGAAaAAAGATGGCAAAG-3¢) ... VA, USA), was used as a template The sequences of the PCR primers are 5¢- TGGGTTTGAGAGCATATGAAGTTGG CAAAAAAATACTAC-3¢ for primer 1, 5¢- CGCATATG GAGACGATGATCGCCTACGTCGATG-3¢ for primer 2, 5¢-ACCGTTAAGCTTTCATAAACATCCTCCTTT-3¢ ... D29 substrate with various RNase H enzymes is summarized in Fig 6C,D Tma-RNase HI, Eco-RNase HI, Sto-RNase HI and Tk-RNase HII cleaved this substrate most preferably at a1 6 -a1 7, a1 5 -a1 6, a1 4 -a1 5...
Ngày tải lên: 06/03/2014, 22:21
Báo cáo khoa học: Sequences downstream of the transcription initiation site are important for proper initiation and regulation of mouse ribonucleotide reductase R2 gene transcription ppt
... reporter constructs as templates Creation of a TATAWt UTRWtG-less cassette construct with exactly the same 5¢-UTR sequence as the analogous luciferase construct failed probably because primers specific ... promoter-luciferase constructs, TATAWtUTRWt (m) and TATAmutUTRWt (j) The graph shows relative luciferase values at the indicated time points after release from serum starvation Our results so far indicate a ... essentially as described in [26] Avian myeloblastosis virus reverse transcriptase, T4 polynucleotide kinase and /X174 DNA/HinfI dephosphorylated marker were purchased from Promega RNAs to be used as...
Ngày tải lên: 08/03/2014, 02:20
Such Stuff as Dreams The Psychology of Fiction pdf
... themselves and something else As shell was also a bead A piece of wood was also a musical instrument Charcoal and ochre marks on a cave wall were also a rhinoceros In a story told at a burial, someone ... stories came to him as dreams.14 So rather than a direct impression, this was what literary art was, a kind of dream Not far into Romeo and Juliet, Shakespeare depicts Romeo as seeing, across ... It s just that it s only half the issue, maybe less than half As Stephen Halliwell has shown, the Greek word, mimesis also had a second family of meanings that are less widely discussed, and sometimes...
Ngày tải lên: 14/03/2014, 21:20
Báo cáo khoa học: Hybrid reuteransucrase enzymes reveal regions important for glucosidic linkage specificity and the transglucosylation / hydrolysis ratio pptx
... (Stratagene, La Jolla, CA, USA) and the primers AkpnI: 5¢-GATACATGGTATCGTCCAAAAC-3¢; AsacI: 5¢-GTG AAGAAATATGAGCTCTATAATATTCCGG-3¢; and Asa lI: 5¢-CTTGCTAACGATGTCGACAACTCTAATCC-3¢ (complementary ... Oligosaccharide synthesis from sucrose and isomaltose by hybrid enzymes GTFA-O1 ⁄ O2 had a distribution of oligosaccharides synthesized from sucrose and isomaltose similar to GTFO-dN-RS; thus, ... acceptor substrates maltose or isomaltose (100 mm each), Hybrid reuteransucrases and linkage specificity the oligosaccharides synthesized were analyzed by anion exchange chromatography (Dionex) as...
Ngày tải lên: 16/03/2014, 04:20
Báo cáo khoa học: Apolipoproteins A-I and A-II are potentially important effectors of innate immunity in the teleost fish Cyprinus carpio pot
... affinity chromatography display essentially two Design and evaluation of apoA-I synthetic peptide Based on our observations and on several studies that have shown that mammalian apoA-I associated ... proteolysis of HDL-associated apoA-I (A) TricineSDS/PAGE and Coomassie blue staining were used to analyze the progress of HDL-associated apoA-I proteolysis with chymotrypsin (B,C) Western blot analyses ... of HDL-associated apoA-I is remarkably similar, displaying an arrangement of several amphipatic ahelices in a horseshoe-shape structure [12] In fact, it has been demonstrated that various HDL...
Ngày tải lên: 16/03/2014, 18:20
Leadership the Hard Way: Why Leadership Can’t Be Taught and How You Can Learn It Anyway
... was assassinated That first year, civil rights became a burning issue on campus as scores of students were arrested at sit-ins designed to force Bay Area businesses to hire more black employees ... relatively stable markets and competitors, survival was only rarely an issue To be sure, every now and then a company might face a major crisis, but once that crisis was addressed, things went back to ... wisdom, instincts, and initial impulses and impressions Second, to lead against the current, you must be unafraid to make decisions or take actions that appear “crazy.” Sometimes they may in fact...
Ngày tải lên: 16/03/2014, 21:03
.Get More and Do More at Dummies.com ®Start with FREE Cheat SheetsCheat Sheets include • Checklists • Charts • Common Instructions • And Other Good Stuff!To access the Cheat Sheet created specifically for this book, go towww.dummies.com/cheatsheet/e pptx
... often pay much less in management fees than individual investors for shares in the same mutual fund (Fund companies often refer to institutional class versus investor class shares All that really ... from an accounting scandal to the CEO s sudden angina attack can send a single stock spiraling downward That s why it makes sense for the average investor to own lots of stocks — or bonds — through ... the National Association of Personal Financial Advisors (NAPFA) since 2002, Wild is also a long-time member and past president of the American Society of Journalists and Authors (ASJA) The author...
Ngày tải lên: 16/03/2014, 21:20