a research or policy agenda

... in half space or an exterior domain of any bounded region with smooth boundary under the assumption that initial data is near constant state On large time asymptotic behavior, Kagei and Kobayashi ... boundary data for (2.1.2) and (2.1.3) 2.2 A simple Toolbox for the Laplace Transformation Let f (t) be a function defined in t ≥ 0, its Laplace transformation F (s) and the inverse transformation ... transform variable, we can apply complex analysis as that in Theorem 2.3 to obtain all the boundary data in physical variables with exponentially sharp estimates Theorem 2.9 Let Λ ∈ (−1, 1) and κ...

Ngày tải lên: 09/09/2015, 08:17

... [43] Apaf1, caspase-9 and cytochrome c form the apoptosome where caspase9 undergoes a conformational change, rather than cleavage, allowing for proteolytic cleavage of substrates that can include ... mitochondria and possible release of cytochrome c, which also can lead to apoptosome formation and caspase-9 activation [45] Over-expressed LRRK2 can therefore enhance caspase cleavage in an apparent ... c activates apoptosome formation Initiator caspase-9 undergoes a conformational change, activating photolytic activity The apoptosome cleaves effector caspase-3, which may result in cell death...

Ngày tải lên: 23/03/2014, 04:20

... Novel clinical markers of vascular wall inflammation Circ Res 2001, 89:763-771 Gonzalez-Juanatey C, Llorca J, Garcia-Porrua C, SanchezAndrade A, Martín J, Gonzalez-Gay MA: Steroid therapy improves ... Cardiol 2001, 37:517-520 Protogerou A, Lekakis J, Stamatelopoulos K, Aznaouridis K, Karatzis E, Ikonomidis I, Papamichael Ch, Markomihelakis N, Mavrikakis M, Kaklamanis PG: Arterial wall characteristics ... status of the arterial wall smooth muscle All participants gave informed consent and the protocol was approved by the Alexandra Hospital's research ethics committee Statistical analysis Statistical...

Ngày tải lên: 09/08/2014, 10:21

... ventral and lateral aspects, and also in Figure in sagittal and axial views Both plates evince the fact that the greater volume of the gaster is occupied by the air sacs and that these sacs are ... surrounded by a branch of a trachea Tracheal branches in fact pass between all the PPs and on a warm summer day, their function is perhaps to cool the PPs by airflow and maintain them at a uniform, low ... An important factor which contributes to the efficacy of blood and haemolymph as carriers of heat is their large heat capacity, similar to that of pure water By contrast, a factor which detracts...

Ngày tải lên: 11/08/2014, 00:22

... interviews and selfadministered questionnaires on lifestyle and health related factors, medical history and respiratory symptoms were performed Cardiovascular (heart attack, stroke) and pulmonary diseases ... graduation (less than O-level, O-level and more than O-level) Furthermore, the use of medication within the last seven days before the examination was ascertained by an instrument for database-assisted ... Meisinger, A Peters and to all co-workers who are responsible for the design and conduct of the KORA studies Source of Funding The KORA research platform (KORA, Cooperative Research in the Region of Augsburg)...

Ngày tải lên: 25/10/2012, 10:45

... connectivity and are discussed separately for each task The ROIs were delineated based on the group-averaged activations for each task, and mean parameter estimates were correlated with dorsal PFC ... significant activations in the bilateral middle frontal gyrus (BA 9/46), bilateral inferior frontal gyrus (BA 44/45), anterior cingulate gyrus (BA 32), and bilateral parietal cortex (BA 7) (for a complete ... is also some Nordahl et al 425 Table Activations for Verbal Item Recognition Task at High-load Working Memory Task Table Activations for Verbal Item Recognition Task at Low-load Working Memory...

Ngày tải lên: 14/02/2014, 07:20

... N, Amemiya-Kudo M, Yoshikawa T, Hasty AH, Tamura Y, Osuga J, Okazaki H, Iizuka Y et al (2002) Dual regulation of mouse Delta(5)- and Delta(6)-desaturase gene expression by SREBP-1 and PPARalpha ... Polyunsaturated fatty acids modulate sodium and calcium currents in CA1 neurons Proc Natl Acad Sci USA 93, 12559–12563 27 Nakamura MT & Nara TY (2002) Gene regulation of mammalian desaturases Biochem ... developing brain are formed after the differentiation of astrocytes [53,54], and it was demonstrated that astrocytes are required for the formation, maturation and maintenance of synapses in neuronal cultures...

Ngày tải lên: 18/02/2014, 13:20

... YCplac111 pAS2-1 pACT2 pAM236 pAM237 pAM241 pAM252 pAM253 pAM872 pAM873 pAM874 pAM875 pAM876 pAM877 pAM878 pAM879 pAM880 pAM881 pAM882 pAM883 pAM884 pAM885 pAM886 pAM887 pAM888 pAM889 pAM890 pAM891 ... Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY 66 Sambrook J, Fritsch EF & Maniatis T (1989) Molecular Cloning: A Laboratory Manual, 2nd edn Cold Spring Harbor Laboratory Press, Cold ... pAM890 pAM891 pAM892 pAM895 pAM896 pAM899 pAM902 pAM903 pAM904 pAM905 pAM906 pAM907 pAM908 pAM909 pAM910 pAM912 pAM913 pAM914 pAM915 pAM918 pAM919 pAM1001 pAM1002 pAM1003 Vector for expression...

Ngày tải lên: 18/02/2014, 16:20

... peroxisome proliferator-activated receptor-alpha (PPARa) and peroxisome proliferator-activated receptor-gamma coactivator-1 (PGC-1), pivotal nuclear regulators of numerous fatty acid metabolic genes ... receptor alpha (ERRa) functions in PPARgamma coactivator 1alpha (PGC- 1a) -induced mitochondrial biogenesis Proc Natl Acad Sci USA 101, 6472–6477 14 Rangwala SM, Li X, Lindsley L, Wang X, Shaughnessy ... MFE thanks the South African Medical Research Council and National Research Foundation for financial support The work of HT was supported in part by grants from the NHLBI (RO1-HL073162-01 and T32-HL07591)...

Ngày tải lên: 18/02/2014, 16:20

... Standards for the Professional Practice of Internal Auditing Standards starting at 1xxx are Attribute Standards and Standards starting at 2xxx are Performance Standards See International Professional ... products and operational changes and ensure that all associated risks, known and anticipated, are identified and communicated at an early stage 46 Senior management should be accountable for ensuring ... responsible for establishing an annual internal audit plan that can be part of a multi-year plan The plan should be based on a risk assessment (including input from senior management and the board) and...

Ngày tải lên: 06/03/2014, 10:20

... International Standards for the Professional Practice of Internal Auditing Standards starting at 1xxx are Attribute Standards and Standards starting at 2xxx are Performance Standards See International ... that all associated risks, known and anticipated, are identified and communicated at an early stage 51 Senior management should be accountable for ensuring that timely and appropriate actions are ... be applied in accordance with the national legislation and corporate governance structures applicable in each country For large banks and internationally active banks, an audit committee (or...

Ngày tải lên: 06/03/2014, 10:20

... Australia created a new landscape pattern that altered climate A large block of newly cleared agricultural land was separated from the original heath vegetation by a rabbit fence, producing a ... pattern Dynamic Spatial Pattern–Dynamic Lateral Transfers Here, spatial patterns are not stationary, and flows are assumed to respond to changes in the landscape template Landscapes are constantly ... identify areas of high or low rates, or to quantify the spatial pattern or scale of variability in rates Lateral transfers are flows of materials, energy, or information from one location to another...

Ngày tải lên: 06/03/2014, 18:21

... Cyanidioschyzon merolae (BAC67668), Guillardia theta (AAK39722), Parachlorella kessleri (P28996), Chlorella pyrcnoidosa (BAE48222), Beta vulgaris (CAB09900), Arabidopsis thaliana (AAF02837), Oryza ... Glugea plecoglossi (BAA11470), Ashbya gossypii (AAS53513), Candida albicans (CAA70857), Schizosaccharomyces pombe (CAB58373), Neurospora crassa (AAK49353), Gibberella zeae (XP_389750), Aspergillus ... Miyazawa K, Yamaguchi K, Nowaki K, Iwatsuki H, Wakamatsu Y, Ichikawa N & Hashimoto T (2001) Deletion of mitochondrial ATPase inhibitor in the yeast Saccharomyces cerevisiae decreased cellular and...

Ngày tải lên: 07/03/2014, 05:20

... pituitary adenylate cyclase-activating polypeptide, secretin, vasoactive intestinal peptide, 12-Otetradecanoylphorbol 13-acetate (TPA) from Bachem AG (Switzerland); anti-Crk mAb, anti-p130Cas mAb, ... lgÆmL)1 anti-p130Cas or 0.025 lgÆmL)1 anti-paxillin Statistical analyses All data provided are reported as mean ± SEM Data were analysed using Student’s t-test and only values with P < 0.05 were accepted ... rat pancreatic acini Recently, it has been demonstrated that CCK activates different intracellular pathways in rat pancreatic acinar cells [2] We have demonstrated previously in these cells that...

Ngày tải lên: 07/03/2014, 21:20

... (and GST alone) after incubation with equal amounts of in vitro translated 35 S-labelled DYS-1 The signal intensity of the autoradiogram was quantitated with a radiographic analyser (Biorad) MW, ... phenotypes arising from mutations in dystrophin-related genes in Caenorhabditis elegans Curr Biol 10, 1092–1097 21 Harlow, E & Lane, D (1988) Antibodies, a Laboratory Manual Cold Spring Harbor Laboratory ... transgenes Fig Yeast two-hybrid assay A plate containing SD media minus leucin, tryptophan and histidine was seeded with yeast carrying DNABD-Dys-1 and various AD-Dyb-1 plasmids or empty pACT2...

Ngày tải lên: 08/03/2014, 23:20

... Development and Function in Cephalopods TABLE A general scale of maturity stages for male and female cephalopods (AG gland, SP = spermatophore, SOC = spermatophoric organ complex.) 71 =accessory glands, ... to form the spermatophore (Drew, 1919) Spermatophores usually accumulate in the Needham sac Each spermatophore is therefore analogous to a single egg laying of a female squid Usually only a portion ... Preliminary activity in accessory glands takes place shortly before the mature sexual cells are expelled, i.e formation of preliminary spermatophores takes place in the spermatophoric gland (Laptikhovsky...

Ngày tải lên: 14/03/2014, 16:20

... before the project began N AT UR A L L I GH T R E C L A I ME D WO O D NAT U R AL M ICR O CLIM AT E With a glass curtain-wall facade and strategically placed exposures on the side and rear elevations, ... Princeton Architectural Press New York The National Building Museum Washington, D.C the Alanna Stang and Christopher Hawthorne g ho reen use New Directions in Sustainable Architecture Copyright For András, ... Domat/Ems to meet an architect named Dietrich Schwarz Though still in his thirties, Schwarz has already earned a reputation as one of Switzerland’s leading practitioners of the environmentally...

Ngày tải lên: 14/03/2014, 17:20

... The Authors Journal compilation ª 2010 FEBS U Barash et al 51 Tang W, Nakamura Y, Tsujimoto M, Sato M, Wang X, Kurozumi K, Nakahara M, Nakao K, Nakamura M, Mori I et al (2002) Heparanase: a key ... Purushothaman A, Uyama T, Kobayashi F, Yamada S, Sugahara K, Rapraeger AC & Sanderson RD (2010) Heparanase-enhanced shedding of syndecan-1 by myeloma cells promotes endothelial invasion and angiogenesis ... Yang Y, MacLeod V, Dai Y, Khotskaya-Sample Y, Shriver Z, Venkataraman G, Sasisekharan R, Naggi A, Torri G, Casu B et al (2007) The syndecan-1 heparan sulfate proteoglycan is a viable target for...

Ngày tải lên: 15/03/2014, 23:20

... appropriate primers (Pf LDH: forward 5¢-ATGGCACCAAAAGCAAAAATCG-3¢ and reverse 5¢-AGCTAATGCCTTCATTCTCTTAG-3¢; Pf MQO forward 5¢-ATGATATGTGTTAAAAATATTTTG-3¢ and reverse 5¢-TCATAAATAATTAACGGGATATTCG-3¢) ... LEIVNLHA—-SPYVAPAAAIIEMAESYLKDLKKVLICSTLLE-G-QYGHSD-IFGGTPVV AEIIKLAK-ASAAFAPAAAITKMIKSYLYNENNLFTCAVYLN-G-HYNCSN-LFVGSTAK GEIVKLLKTGSAYYAPAASAIAMLESYLKDKRQILTCAAYLQ-G-EYDIHD-LYIGVPII AEIVGLLKTGSAYYAPAASAIEMAESYLKDKKRVLPCAAHLS-G-QYGVKD-MYVGVPTV ... pure and intact Plasmodium falciparum plasma membrane vesicles and partial characterization of the plasma membrane ATPase Malar J 1, 1–7 28 Bradford, M.M (1976) A rapid and sensitive method for...

Ngày tải lên: 16/03/2014, 18:20

... gallate at mm for -OH and alkoxyl radicals, and SOD and catalase at 250 lgÆmL)1 for O2– and H2O2, respectively [28,29] • S Rajagopal et al temperature of 20 °C Each CD spectrum was the average ... defense or adaptation [23–25] Several authors proposed that oxidative mechanisms are at the basis of PSI photodamage in intact leaves [19,22], isolated chloroplasts [7,8,11], and isolated PSI fragments ... PsaA was stable until h of illumination and then started degradation (Fig 4) The PSI core is mainly composed of bulk antenna Chl that absorbs in a broad band with a maximum at 680 nm, but also...

Ngày tải lên: 16/03/2014, 18:20