a paradigm for the curative treatment of human malignancies

Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_2 pdf

Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_2 pdf

... individual market participants, but for capital markets as a whole. ‘Central Counter- parties are among the crucial building blocks of any well-organised financial system. They facilitate the allocation ... of a financial market. 170 The effectiveness of a CCP’s risk management and sufficient levels of financial resources are therefore crucial for the stability of the markets, which are served by the ... incl. revaluation of positions on a daily or intra-day basis using mark-to-market, collection of margins. • Mark-to-market and collateralisation disciplines create savings at the operational level,...

Ngày tải lên: 21/06/2014, 07:20

38 345 0
acute myeloid leukaemia a paradigm for the clonal evolution of cancer

acute myeloid leukaemia a paradigm for the clonal evolution of cancer

... et al., 2008) As the RUNX1 mutations are shared by family members, the variable penetrance and age of onset of haematopoietic malignancy indicate that either the rate of acquisition of cooperating ... targeted therapies at the earliest possible time, akin to combination antiretroviral therapy in HIV (Goldie and Coldman, 1984) There are theoretical advantages of attacking an identifiable (pre)leukaemic ... whether such an approach has a role in AML Another novel approach under investigation is that of adaptive therapy (Gatenby et al., 2009) As opposed to conventional therapeutic approaches aiming to...

Ngày tải lên: 02/11/2022, 08:56

11 0 0
Structural basis for the inhibition mechanism of HUman CSE and a study on c CBL complexes

Structural basis for the inhibition mechanism of HUman CSE and a study on c CBL complexes

... persulphide and polysulphide. Sulphide can also bind to plasma proteins such as albumin, and it can activate ATP-activated potassium (KATP) channels in the myocardium, vascular smooth muscle and cardiac ... reperfusion (IRI NaHS). *Pgi|262476|gb|AAB24700.1| cystathionine gamma-lyase [Homo sapiens] MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSG FEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHLLKAGDQIICMDDVY ... This state is readily reversible and does not appear to harm the animal, suggesting the possibility of inducing suspended animation-like states for medical applications such as ischemia and reperfusion...

Ngày tải lên: 11/09/2015, 10:17

138 314 0
Stereotactic ablative radiotherapy for the comprehensive treatment of 1–3 Oligometastatic tumors (SABR-COMET-3): Study protocol for a randomized phase III trial

Stereotactic ablative radiotherapy for the comprehensive treatment of 1–3 Oligometastatic tumors (SABR-COMET-3): Study protocol for a randomized phase III trial

... Stewart Gaede7, Andrew Warner3, Tanja D de Gruijl13, Alison Allan7 and David A Palma7 Abstract Background: A recent randomized phase II trial evaluated stereotactic ablative radiotherapy (SABR) ... ablation of those metastases is deemed to be clinically required regardless of the treatment of extracranial metastases, ablative treatment is permitted to the brain metastases as long as at least ... hospitals or Olson et al BMC Cancer (2020) 20:380 radiotherapy (RT) treatment centres in Canada, the United Kingdom, the Netherlands, and Australia (updated country list available on ClinialTrials.gov...

Ngày tải lên: 30/05/2020, 21:29

12 22 0
Báo cáo Y học: The S100A8/A9 protein as a partner for the cytosolic factors of NADPH oxidase activation in neutrophils doc

Báo cáo Y học: The S100A8/A9 protein as a partner for the cytosolic factors of NADPH oxidase activation in neutrophils doc

... GTPcS-loaded Rac2, MgSO 4 and an optimal amount of arachidonic acid determined for each assay of oxidase activation [12]. The rate of O 2 – production by the activated NADPH oxidase was calculated ... traces of protein contaminant [15]. The identity of S10 0A8 was further ascertained by amino-acid sequencing, using Edman degra- dation. As S10 0A9 has a blocked N-terminal amino acid, analysis of the ... dismutase. NADPH oxidase activity was also assayed by polarographic meas- urement of the rate of O 2 uptake at 20 °CwithaClark electrode at a voltage of 0.8 V. All experiments were carried out at...

Ngày tải lên: 18/03/2014, 01:20

10 396 0
Future R&D Environments A Report for the National Institute of Standards and Technology potx

Future R&D Environments A Report for the National Institute of Standards and Technology potx

... was approved by the Governing Board of the National Research Council, whose members are drawn from the councils of the National Academy of Sciences, the National Academy of Engineering, and the ... to the furtherance of science and technology and to their use for the general welfare Upon the authority of the charter granted to it by the Congress in 1863, the Academy has a mandate that requires ... the charter of the National Academy of Sciences, as a parallel organization of outstanding engineers It is autonomous in its administration and in the selection of its members, sharing with the...

Ngày tải lên: 23/03/2014, 01:20

233 408 0
Báo cáo khoa học: Structural requirements for the apical sorting of human multidrug resistance protein 2 (ABCC2) potx

Báo cáo khoa học: Structural requirements for the apical sorting of human multidrug resistance protein 2 (ABCC2) potx

... Wada, M., Kohno, K., Nakamura, T., Kawabe, T., Kawakami, M., Ka gotani, K., Okumura, K., A kiya ma, S. & Kuwano, M. (1996) A human canalicular multispecific organic anion transporter (cMOAT) ... 5¢-CCGCGG CTATTCCTTAGCCATAAAGTAAAA-3¢ (MRP2D11), 5¢-CCGCGGCTAAAAGTAAAAGGGTCCAGGG-3¢ (MRP2D15), 5¢-CCGCGGCTAAGGGATTTGTAGCA GTTCT-3¢ (MRP2D20), 5¢-CCGCGGCTATTCTTCA GGGCTGCCGC-3¢ (MRP2D25), 5 ¢-CCGCGGCTATTC CTTAGCCATTTCTTCAGGGCTGCCGC-3¢ ... Molecular Biochemicals (Indianapolis, IN, USA). R hodamine-conju- gated concanavalin A was from Vector Laboratories (Burlingame, CA, USA). All other chemicals were of analytical grade and obtained...

Ngày tải lên: 31/03/2014, 09:20

11 523 0
Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_1 pptx

Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_1 pptx

... Partners and former Chairman of the Securities and Exchange Commission ‘Particularly in the light of recent market dislocations, clearing is critical for the assurance of a healthy functioning of the ... academic methodology. The findings of the book do not necessarily represent the of? ??cial stance of Barclays Capital. The International Capital Market Association’s sponsorship of this publication ... Network Categorisation of direct transaction costs Categorisation of clearing- related cost of capital Categorisation of clearing- related risk management costs Categorisation of clearing-...

Ngày tải lên: 20/06/2014, 18:20

38 542 0
Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_2 pptx

Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_2 pptx

... exchange- traded derivatives in the past decade has been accompanied by an increasing internationalisation of the markets and their clearing arrangements. 46 Insti- tutional and individual traders ... collateral management ensures that margin requirements are covered by available collateral If there is a collateral shortfall, a collateral call is generated If there is collateral excess, a ... CCPs and explains why the application of CCP clearing could have ramifications for Europe and beyond. The author also briefly explores the case for a Single CCP at both the European and global levels,...

Ngày tải lên: 20/06/2014, 18:20

38 584 0
Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_4 potx

Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_4 potx

... applicable. The cost of capital a clearing member has to bear in compliance with a clearing house’s risk management requirements can be regarded as an offset for the risk assumed by the CCP for the clearing ... minimum financial and capital adequacy requirements on clearing members. These risk-management measures translate into cost of capital for clearing members. 62 Generally, cost of capital can be reduced ... transaction costs. Because these costs are difficult to quantify monetarily, they can often only be estimated. For the purpose of this study, they are categorised as cost of capital, risk management...

Ngày tải lên: 20/06/2014, 18:20

38 469 0
Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_5 potx

Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_5 potx

... approach (rather than a purely questionnaire-based a pproach or sending out the questionnaire prior to the interview) was based on the partially explorative angle of this research, the nature of the ... to the complexity of the research question and the general lack of publicly available studies, data and insight, a semi-structured approach was chosen to afford more flexibility as well as the ability ... regarding the case study assessment in Chapter 8. 13 Because the likelihood of failing to gather quantitative cost data via the questionnaire was expected ex ante, a ‘workaround’ enabling a cost...

Ngày tải lên: 20/06/2014, 18:20

38 617 0
Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_6 doc

Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_6 doc

... of analysis facilitates the comparison of the per-contract fees charged by clearing houses by equalising the different contract values. Although it can be assumed that the contract value is at ... Clearing, LCH.Clearnet, OMX Clearing, ... cost categories All of these factors are detailed in the following paragraphs Whereas the validation of the data on clearing house charges ... Since then, Euronext.liffe and LCH.Clearnet have charged separate tr ading and clearing fees. 67 Eurex and the Clearing Corporation planned to charge a link fee of €0.05 for the clearing of the...

Ngày tải lên: 20/06/2014, 18:20

38 418 0
Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_7 pdf

Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_7 pdf

... balance and off-balance activities Malkam¨ ki a (1999) and Schmiedel/Malkam¨ ki/Tarkka (2002) estimate translog cost functions for their studies, a relying on a broader sample of data ... of data available for their focus area Book (2001) on the other hand copes with the problems related to the limited availability of data for his research by providing an analysis... ... The analysis supports that decreasing average costs are related to an increase in the number of contracts cleared The linear... available for quantifying the output of derivatives...

Ngày tải lên: 20/06/2014, 18:20

38 515 0
Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_9 docx

Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_9 docx

... smaller; they don’t have the capital of a Morgan Stanley or a Goldman Sachs, so the Asian clearing houses can play a role in representing the financial standing and credit standing ... location. Rather in a first instance, the respective exchanges must give allowance to the use of various clearing houses. [...]... access to the away market: Many of the Asian brokerage ... initiative still qualifies as a valuable case study analysis for various reasons: first and foremost, the link involves one of Europe’s largest... What theory reveals – framework for analysis...

Ngày tải lên: 20/06/2014, 18:20

38 406 0
Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_10 pdf

Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_10 pdf

... required ECAG to deal with a greater number of technical, operational and legal adaptations than CCorp. Although Phase II has not been implemented to date, both clearing houses had already started ... engage in the development of necessary changes by the end of 2004 and in 2005. In 2005, ECAG wrote these costs off as extr aordinary depreciation. Due to the unavailability of detailed cost data, ... cannot become clearing members of ECAG. Prior to the introduction of Phase I of the GCL, they therefore had to employ a clearing intermediary that was a member of ECAG to clear their t rades executed...

Ngày tải lên: 20/06/2014, 18:20

38 630 0
Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_12 pdf

Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_12 pdf

... initiatives (as a particular form of M& ;A initiatives) have the drawback that the majority of resources must be committed to the inte- gration of the partnering clearing houses; this type of ... clearers no choice of participation; participation is obligatory. The magnitude of the increase of indirect costs depends on the structure of the initiative and the char acteristics of the clearing ... stakeholders. Furthermore, there are many kinds of clearing link initiative, and not all of them can serve to increase the efficiency of European clearing. Therefore, the parameters and prerequisites...

Ngày tải lên: 20/06/2014, 18:20

38 395 0
Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_13 ppt

Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_13 ppt

... delivered. Although the focal point of the research was the European exchange-traded derivatives clearing industry, the results of the analysis were eventually applied to European exchange-traded cash ... increasingly aware of clearing costs; many of them view obtaining clearing membership as a viable cost-cutting strategy. The cost analysis also provided the critical step of generating a quantitative ... future, European rules and regulations are harmonised, and processes are standardised, a reviewed analysis of the dynamics of the clearing. .. processes • Adaptation of risk management...

Ngày tải lên: 20/06/2014, 18:20

38 497 0
Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_14 pdf

Clearing Services for Global Markets A Framework for the Future Development of the Clearing Industry_14 pdf

... charges are accounted for at a later stage of the calculation of total clearing. .. calculation was built on the status quo of the cost structures for the benchmark clearing ... members and the remaining 213 European clearers, as classified in Appendix 7 This assumption was due to a lack of data that would have allowed for an accurate assessment regarding the changes ... Average daily cash margin at clearing house in 2005 Average daily collateral margin at clearing house in 2005 Average daily credit lines/capital tied to ensure funding of intra- day margin calls...

Ngày tải lên: 20/06/2014, 18:20

38 321 0
MYELOID LEUKEMIA – BASIC MECHANISMS OF LEUKEMOGENESIS docx

MYELOID LEUKEMIA – BASIC MECHANISMS OF LEUKEMOGENESIS docx

... Hongfeng Yuan and Zhiqiang Wang Chapter Targeting the Chronic Myeloid Leukemia Stem Cell: A Paradigm for the Curative Treatment of Human Malignancies 85 Adrian Woolfson and Xiaoyan Jiang Chapter The ... Leukemia 449 Soraya Gutierrez, Amjad Javed, Janet Stein, Gary Stein, Sandra Nicovani, Valentina Fernandez, Ricardo Alarcon, Marcela Stuardo, Milka Martinez, Marcela Hinojosa and Boris Rebolledo-Jaramillo ... Abdullah and Zainina Seman Chapter 21 Role of Signaling Pathways in Acute Myeloid Leukemia 429 Maha Abdullah and Zainina Seman Chapter 22 Epigenetic Changes Associated with Chromosomal Translocation...

Ngày tải lên: 27/06/2014, 17:20

496 405 0
Consumer goods and life sciences consumer care, the new frontier for engagement

Consumer goods and life sciences consumer care, the new frontier for engagement

... Safe Harbor Safe harbor statement under the Private Securities Litigation Reform Act of 1995: This presentation may contain forward-looking statements that involve risks, uncertainties, and assumptions ... revenues, or other financial items and any statements regarding strategies or plans of management for future operations, statements of belief, any statements concerning new, planned, or upgraded services ... reselling non-salesforce.com products, and utilization and selling to larger enterprise customers Further information on potential factors that could affect the financial results of salesforce.com,...

Ngày tải lên: 07/03/2016, 18:13

13 250 0
w