a p and d v networks

Ngày tải lên: 05/08/2014, 15:20

... and bounded The map z : PA → LA defined in Section clearly embeds a copy of the dual of PR in LA Hence the image z(PR ) is a subposet of LA whose proper part is (d − 2)-spherical (meaning that ... 430–463 [16] M Jambu and H Terao, Free arrangements of hyperplanes and supersolvable latties, Advances in Math 52 (1984), 248–258 [17] T J´zefiak and B E Sagan, Basic derivations for subarrangements ... d- polytope, and the open interval (PA )

Ngày tải lên: 07/08/2014, 08:22

Ngày tải lên: 19/01/2014, 07:20

... building appears to have had at least one standing stone inside it, and that one house actually had three The plaster-covered human shaped obelisk (9) shoulders and the stumps of arms and part ... that people enjoy crying together almost as much as laughing together A world B place C earth D space A communicate B persuade C inform D demonstrate A evolve B change C develop D alter A doing ... part of a neck The “head”, however, (10) Page 3/4 A B C D E F G H ever discovered by archaeologists molded into the shape to have been built strangely carved was fashioned by people excavations...

Ngày tải lên: 23/11/2015, 07:07

... bd ⇒ BD Sơ đồ BD bd : bd bd x bd bd  Nếu kết kiểu hình lai phân tích tạo loại kiểu hình 0,25 0,25 bd ⇒ BD bd ≠ Bd bD Sơ đồ BD bd x bd bd = bd bd = bd - Tự thụ phấn (hay giao phối gần động v t) ... Xét c p alen AA nằm c p nhiễm sắc thể thường, alen d i 408 nanomet, tỉ lệ G A : G = : Đột biến làm alen A thành alen a, tạo nên c p d h p Aa Alen a có tỉ lệ A ≈ 33,48% chiều d i không đổi a Đột ... 12,5%Ab// ab 12,5% ngọt, bầu d c; 12,5% ab// ab 12,5% chua, tròn; - F1: AB//ab x thứ hai: Ab//ab; G: 37,5%AB, 37,5%ab,12,5%Ab,12,5% aB 50% Ab;50% ab KG: 18,75%AB//Ab; 18,75%AB//ab; 6,25% Ab//aB...

Ngày tải lên: 23/11/2015, 07:07

... (bụi xanh dng nht) v thuc a t nhỡ (sau 1800) (xanh dng m) ca thc d n Ph p CNG C -Tỡnh hỡnh kinh teỏ ,chớnh tr ni bt cu a Anh vaứ Ph p cui theỏ kổ XIX u XX ? -c im ging c bn ca CNQ Anh v Ph p l ... THUC A ANH quc Anh (phn mu ) nm 1897 BI 35 : CC NC ANH,PHP, C,M V S BNH TRNG THUC A Tit Nhúm tỡm hiu tỡnh kinh t nc 1.Nc Anh Ph p 2.Nc ph p a. Tỡnh hỡnh kinh t: + Ph p tht bi CT ct * Cụng nghip ... ca CNQ Ph p l gỡ? BI 35 : CC NC ANH,PHP, C,M V S BNH TRNG THUC A Tit 1.Nc Anh 2.Nc ph p a. Tỡnh hỡnh kinh t: b.Tỡnh hỡnh chớnh tr - i ni + Sau CM 1870 Ph p lp nn cng ho th song phõn hoỏ thnh hai...

Ngày tải lên: 10/09/2013, 00:10

... = ị VDPQCNB = VMCNB MC MN MB 6 ã V D l trung im ca MC nờn d ( M ,(CNB)) = 2d (D ,(CNB)) ị VMCNB = 2VDCNB = VDCSB = VS ABCD ị VDPQCNB = VSABNPQ 7 VS ABCD ị VSABNPQ = VS ABCD ị = 12 12 VDPQCNB ... (a - 3)2 + (a + 3)2 - 2 = (a - 5)2 + (a + 5)2 - a = ị I(0; 1), R = ị Phng trỡnh (C): x + ( y + 1)2 = r r r r 2) Gi ud , uD , nP ln lt l cỏc VTCP ca d, D v VTPT ca (P) Gi s ud = (a; b; c ) (a2 ... x - x dx t x = sin t Tớnh c: B = 2p -2 ã Tớnh B = x - x dx = A + B ũ ã Tớnh A = = -2 Cõu IV: Gi P = MN ầ SD, Q = BM ầ AD ị P l trng tõm DSCM, Q l trung im ca MB ã VMDPQ VMCNB = MD MP MQ 1...

Ngày tải lên: 20/10/2013, 01:15

... = ị VDPQCNB = VMCNB MC MN MB 6 ã V D l trung im ca MC nờn d ( M ,(CNB)) = 2d (D ,(CNB)) ị VMCNB = 2VDCNB = VDCSB = VS ABCD ị VDPQCNB = VSABNPQ 7 VS ABCD ị VSABNPQ = VS ABCD ị = 12 12 VDPQCNB ... (a - 3)2 + (a + 3)2 - 2 = (a - 5)2 + (a + 5)2 - a = ị I(0; 1), R = ị Phng trỡnh (C): x + ( y + 1)2 = r r r r 2) Gi ud , uD , nP ln lt l cỏc VTCP ca d, D v VTPT ca (P) Gi s ud = (a; b; c ) (a2 ... x - x dx t x = sin t Tớnh c: B = 2p -2 ã Tớnh B = x - x dx = A + B ũ ã Tớnh A = = -2 Cõu IV: Gi P = MN ầ SD, Q = BM ầ AD ị P l trng tõm DSCM, Q l trung im ca MB ã VMDPQ VMCNB = MD MP MQ 1...

Ngày tải lên: 12/12/2013, 14:15

... = ị VDPQCNB = VMCNB MC MN MB 6 ã V D l trung im ca MC nờn d ( M ,(CNB)) = 2d (D ,(CNB)) ị VMCNB = 2VDCNB = VDCSB = VS ABCD ị VDPQCNB = VSABNPQ 7 VS ABCD ị VSABNPQ = VS ABCD ị = 12 12 VDPQCNB ... (a - 3)2 + (a + 3)2 - 2 = (a - 5)2 + (a + 5)2 - a = ị I(0; 1), R = ị Phng trỡnh (C): x + ( y + 1)2 = r r r r 2) Gi ud , uD , nP ln lt l cỏc VTCP ca d, D v VTPT ca (P) Gi s ud = (a; b; c ) (a2 ... x - x dx t x = sin t Tớnh c: B = 2p -2 ã Tớnh B = x - x dx = A + B ũ ã Tớnh A = = -2 Cõu IV: Gi P = MN ầ SD, Q = BM ầ AD ị P l trng tõm DSCM, Q l trung im ca MB ã VMDPQ VMCNB = MD MP MQ 1...

Ngày tải lên: 19/01/2014, 04:20

... = ị VDPQCNB = VMCNB MC MN MB 6 ã V D l trung im ca MC nờn d ( M ,(CNB)) = 2d (D ,(CNB)) ị VMCNB = 2VDCNB = VDCSB = VS ABCD ị VDPQCNB = VSABNPQ 7 VS ABCD ị VSABNPQ = VS ABCD ị = 12 12 VDPQCNB ... (a - 3)2 + (a + 3)2 - 2 = (a - 5)2 + (a + 5)2 - a = ị I(0; 1), R = ị Phng trỡnh (C): x + ( y + 1)2 = r r r r 2) Gi ud , uD , nP ln lt l cỏc VTCP ca d, D v VTPT ca (P) Gi s ud = (a; b; c ) (a2 ... x - x dx t x = sin t Tớnh c: B = 2p -2 ã Tớnh B = x - x dx = A + B ũ ã Tớnh A = = -2 Cõu IV: Gi P = MN ầ SD, Q = BM ầ AD ị P l trng tõm DSCM, Q l trung im ca MB ã VMDPQ VMCNB = MD MP MQ 1...

Ngày tải lên: 25/01/2014, 10:20

... GWEQLEQCGYPVQRLVALYLAARLSWNQVDQV IRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVVSLTCP VAAGECAGPADSGDALLERNYPTGAEFLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYV FVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGA ... FVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGA LLRVYVPRSSLPGFYRTSLTLAAPEAAGEVERLIGHPLPLRLDAITGPEEEGGRLETILGWP LAERTVVIPSAIPTDPRNVGGDLDPSSIPDKEQAISALPDYASQPGKPPREDLK613 Fig Structural characteristics of ETA fragments ... intermediates 6b and 6d; and PALA for intermediate 4c Western blot analysis with an antibody against ETA showed that cathepsins B and D degraded ETA in a pH-dependent manner, with maximal degradation...

Ngày tải lên: 18/02/2014, 04:20

... (1996) A novel family of phospholipase D homologues that includes phospholipid synthases and putative endonucleases: identification of duplicated repeats and potential active site residues Protein ... absorbance at 280 nm Aldolase (150 kDa), ovalbumin (45 kDa), chymotrypsinogen A (25 kDa), and cytochrome c (12.3 kDa) (Serva, Heidelberg, Germany) were used as molecular mass standards Absorption and ... data from (A) in the range 0–100 mM Ca2+ (C) Modified Scatchard plot of the data from (B) DA corresponds to the change in relative activity The PLDa2 activity was measured against PpNp in sodium...

Ngày tải lên: 19/02/2014, 02:20

... aspartic proteinases and represents TAPA For the specific determination of CatE and CatD activity, CatE was specifically depleted by immunoprecipitation The remaining activity is due to CatD, and ... (SRFQPSQSSTYSQPG), and gave a complete negative reaction towards the same amount of CatD (10 ng) Values are mean ± SD, n ¼ (Insertion: 10 ng CatE and CatD and ng antigenic peptide were incubated ... analyzed by MALDI-MS This carboxypeptidase activity can only occur after aspartic proteinases have created cleavage products, as the undigested substrate contains a protective d- Arg residue at the...

Ngày tải lên: 07/03/2014, 09:20

... lipid A species Crude lipid A was purified and separated into subfractions according to a modified procedure described by Que and coworkers [9] Briefly, lyophilized lipid A ( 30 mg) was dissolved ... of the distal DAG, and (b) with a- linked galacturonic acid at position of the proximal unit Phosphorylated and nonphosphorylated lipid A preparations are a mixture of three subfractions differing ... were analysed for fatty acids and aminosugars as described previously [24] Neutral and acidic sugars were determined by gas-liquid chromatography and H-NMR experiments were performed in CDCl3/dimethylsulfoxide -d6 ...

Ngày tải lên: 07/03/2014, 15:20

... on a slide with antifade mounting media, and imaged with a laser scanning confocal microscope (Olympus, Tokyo, Japan) Statistical analysis Data are presented as mean ± standard error of the mean ... expression may be an important contributor to increased oxidative mtDNA damage in the inner ear during aging A previous study in mice also reported that the capacity to repair oxidative DNA damage ... 1.7-fold, and 2.5-fold, respectively Decreased mRNA levels of DNA repair enzymes induced by D- Gal To investigate the effect of DNA repair enzymes on the mtDNA damage induced by d- Gal, quantitative realtime...

Ngày tải lên: 14/03/2014, 23:20

... glycoproteins DPP4 (EC 3.4.14.5) and fibroblast activation protein -a (FAP), and the intracellular proteases dipeptidyl peptidase (DPP8) and dipeptidyl peptidase (DPP9) This family of enzymes has ... secretion Vasoactive intestinal peptide (VIP) and pituitary adenylate cyclase-activating polypeptide (PACAP) both bind to the VIP receptor expressed by the liver, pancreas and intestine PACAP is a neurotransmitter ... Neuropeptide Chemokine N-terminal sequence No of amino acids HAEGTF HADGSF YAEGTF HSQGTF HADGVF YADAIF HSQGTF HSDAVF HSDGIF YPIKPE SPKMVQ YPSKPD RPKPQQ ASLAAD SPYSSD GPASVP GPYGAN APLATE VLTELR TPVVRK...

Ngày tải lên: 14/03/2014, 23:20

... Composites 3D knitted composite has a number of important advantages over conventional 2D laminate, particularly very high drape properties and superior impact damage resistance Despite these advantages, ... non-aerospace field, 3D braided composite has been used in propeller blades for a naval landing craft (Maclander et al., 1986; Maclander, 1992) There is also potential application for 3D braided composite ... delamination resistance, and better impact damage resistance and post-impact mechanical properties compared to conventional laminated composites The current and potential applications of 3D composites...

Ngày tải lên: 22/03/2014, 12:20

Ngày tải lên: 22/03/2014, 13:20