a novel multiplex suspension array for rapid subgenogrouping of enterovirus 71 2003

... CA – California, USA; CT – Connecticut, USA; IA – Indiana, USA; MAA – Peninsular Malaysia; OR – Oregon, USA; SAR – Sarawak, Malaysia; SIN – Singapore; TW – Taiwan; TX – Texas, USA The VP1 nucleotide ... hybridization assay format 55 Figure 1.14: Diagram of ASPE, OLA and SBCE procedures used for microsphere capture assays 58 Figure 2.1: Schematic view of multiplex suspension array for EV71 genogrouping ... evolutional rate of EV71, new subgenogroups have been constantly identified The subgenogroup B3 strain was the main causative agent in the epidemics of Sarawak and Peninsular Malaysia in 1997 (Cardosa,...

Ngày tải lên: 16/10/2015, 15:39

... bead-based assays ("bead arrays") Cytometry Part A 2006, 6 9A: 384-390 Hanley B: Variance in multiplex suspension array assays: carryover of microspheres between sample wells Journal of Negative Results ... Ravindran for collaboration Joann Yee and the California Primate Research Center are thanked for generosity in supplying both the sera for these experiments, and use of facilities to run assays ... Education and Forensics of Cheyenne, Wyoming, and KonnectWorld, Inc of Davis, California References Jacobson JW, Oliver KG, Weiss C, Kettman J: Analysis of individual data from bead-based assays...

Ngày tải lên: 13/08/2014, 16:21

... peaks — — peaks — peak peaks peak — aa/aa CS/aa QS/aa WS/aa of mutation carrier samples, as follows: cases of aCSa/ aa, cases of aQSa/aa, and cases of aWSa/aa (Table I) These results were in accordance ... for the duplex PCR products of DNA samples of known genotypes at 50 C SEA/ SEA; SEA/aa; -SEA/aCSa; aa/aa; 5 23.7/aa; 24.2/aa; aQSaa/ aa The peak appeared at 5.1 0.1 min, which indicates aa, ... gap-PCR products to detect 2a3 .7 for DNA samples of known genotypes at 50 C and 2a3 .7/aa; 2a3 .7/ 2a3 .7/ -a3 .7; 5 2a3 .7/ -a4 .2; aa/aa; 2a4 .2/aa All samples carrying 2a3 .7 allele showed a peak at...

Ngày tải lên: 23/03/2014, 22:20

... seroMAPbased approach over ELISA The multiplex A+ PSA assay quantifies autoAb and total PSA in one reaction To develop a multiplex assay that measures total PSA and autoAb in a single reaction, ... prostate cancer, it is necessary to create an index integrating both autoAb against the above-described PCAA and the patient’s PSA status For total PSA and autoAb against each peptide epitope, an ... MD) to quantify total PSA levels seroMAP-based PSA quantification was compared with standard ELISA-based PSA assays (American Qualex) and also made compatible with the measurement of the above-mentioned...

Ngày tải lên: 18/06/2014, 19:20

... seroMAPbased approach over ELISA The multiplex A+ PSA assay quantifies autoAb and total PSA in one reaction To develop a multiplex assay that measures total PSA and autoAb in a single reaction, ... prostate cancer, it is necessary to create an index integrating both autoAb against the above-described PCAA and the patient’s PSA status For total PSA and autoAb against each peptide epitope, an ... MD) to quantify total PSA levels seroMAP-based PSA quantification was compared with standard ELISA-based PSA assays (American Qualex) and also made compatible with the measurement of the above-mentioned...

Ngày tải lên: 20/06/2014, 03:20

... inverters can accommodate a wide range of input dc voltage for an improved energy output from variable wind turbine resources The input source and the output grid are separated based on flyback operation ... exchange and transfer in Mode can be also applied to Mode As a result, in the NHC of ac output, the energy is transferred from dc source to ac grid through L1, L2 and C by the alternations of ... and the current of secondary side reaches to the initial current of primary side, if the inductances and turns of both sides of the coupled inductor are identical and there is no magnetic leakage...

Ngày tải lên: 03/01/2014, 19:16

... thermophilus E coli A pernix 277 277 283 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... Toyobo (Osaka, Japan) Emulgen 911 was a gift from Kao Chemical (Tokyo, Japan) NADPH, NADH and NADP+ were purchased from Oriental Yeast (Tokyo, Japan) a- Cyano-4-hydroxycinnamic acid was obtained from ... acceptor, at 25 °C and at pH 7.4 in the presence of NADH as well as NADPH, the Km value of the FNR for NADPH was about 600-fold lower than that for NADH, and the Vmax value of the FNR with NADPH was about...

Ngày tải lên: 18/02/2014, 08:20

... Biotin-TCGACTAGAAGCTTCTAGAAGCTTCTAG AGCTGATCTTCGAAGATCTTCGAAGAT Biotin-TCGACTTCAAGCTTGTACAAGCTTGTAG AGCTGAAGTTCGAACATGTTCGAACATC Biotin-AACGACGGTCGCTCCGCCTGGCT nM Unlabeled HSE DNA-binding activity ... confirm that the assay specifically measures HSF1 DNA-binding activity Analytical range and precision The analytical range of the assay was evaluated using known concentrations of recombinant human HSF1 ... temperature Assay procedure The assay was run as a three-step assay: initial incubation of the sample and probe, addition and incubation of the sample and acceptor beads in the plate wells, and addition...

Ngày tải lên: 18/02/2014, 14:20

... database (release 48.8) with fixed carbamidomethyl modification of cysteine residues, variable oxidation of methionine and variable deamidation of asparagine and glutamine Parent and fragment mass ... Kristiansen TZ, Jonnalagadda CK, Surendranath V, Niranjan V, Muthusamy B, Gandhi TK, Gronborg M et al (2003) Development of human protein reference database as an initial platform for approaching systems ... supplementary material is available: Fig S1 Application of a simple 2D IEF ⁄ SDS ⁄ PAGEbased protease proteomic approach in substrate finding 2D IEF ⁄ SDS ⁄ PAGE-based image analyses of the second quadrant...

Ngày tải lên: 07/03/2014, 06:20

... data Since the test data tend to have a similar error rate to the narrow standard deviation, we computed the overall performance over the average word spacing error rate, which is 9.1% The baseline ... trained by using the relative frequency information of the training data, and a smoothing technique is applied to relieve the datasparseness problem which is the linear interpolation of n-grams ... contributions of the proposed method eliminating the constant parts Every part of Equation can be calculated by adding the probabilities of all possible combinations of xt−2 , xt−1 , xt+1 and xt+2 values...

Ngày tải lên: 17/03/2014, 02:20

... (D1), and four serotype specific reverse primers (Ts1: 5' CGTCTCAGTGATCCGGGGG 3', Ts2: 5'CGCCACAAGGGCCATGAACAG 3', Ts3: 5' TAACATCATCATGAGACAGAGC 3' and Ts4: 5'TGTTGTCTTAAACAAGAGAGGTC3'), as reported ... (D1: 5' TCAATATGCTAAAACGCGCGAGAAACCG 3' and D2: 5' TTGCACCAACAGTCAATGTCTTCAGGTTC 3') Dengue Nested PCR The nested PCR assay was performed according to the protocol [6] with slight modifications ... no amplification, thereby establishing the specificity of this assay Evaluation of Multiplex RT-PCR The feasibility of the assay for clinical diagnosis was validated by evaluating with serum samples...

Ngày tải lên: 20/06/2014, 01:20

... uniform and non-uniform arrangements In ref [20], different types of array structures for smart antennas (ULA, UCA and Uniform Rectangular Array (URA)), AOA estimation and beamforming performance ... sub-arrays affects the performance of this array Therefore, the PA is an appropriate and simple geometry for AOA estimation and can modify the performance of the conventional ULA in AOA estimation ... spectrum and radio resources Smart antennas or adaptive array antennas are effective techniques for improvement of wireless systems performance A smart antenna system merges an antenna array and a signal...

Ngày tải lên: 21/06/2014, 01:20

... under microwaves irradiation Appl Catal, A 2009, 371( 1-2):22-30 Subrahmanyam KS, Panchakarla LS, Govindaraj A, Rao CNR: Simple Method of Preparing Graphene Flakes by an Arc-Discharge Method J ... performed offer some ideas for mechanical exfoliation of layers from a bulk substrate Use of an ultrasharp wedge as a sectioning method has been used in biological sample preparation and ultrathin samples ... oscillation) and 33.1 kHz, and voltage of 2.1 V are used as process parameters The cleaved layers slide off the diamond wedge surface, are floated on to a water bath arrangement, collected onto a...

Ngày tải lên: 21/06/2014, 06:20

... waveletTANGRAM Next we compare wavelet-TANGRAM to TANGRAM for a few special attacks to demonstrate the feasibility of extending TANGRAM If an attacker arbitrarily intercepts one wavelet-TANGRAM share ... same scene at approximately the same camera orientation A security goal of each node in a cluster is to send partial visual information, which we call shares to a base station or multiple base ... goal is that of secrecy/security, and hence it seems natural and practical to use a random approach Because we cannot expect to achieve global asymptotic stability in a purely random approach,...

Ngày tải lên: 22/06/2014, 23:20

... server maintains a stream information list Each element of the stream information list records the necessary information of a patching multicast stream, described as a triple E(t, I, A) , where ... transmitted at the same time period and that the transmitting video data are shared among grouped clients The mathematical analysis and the experiment results show that the performance of the Medusa scheme ... minutes, the average startup latency is increased to near 750 seconds and almost 45% of clients renege Figures and display a startup latency comparison and a reneging probability comparison among the...

Ngày tải lên: 23/06/2014, 01:20

... screening A value of above 3.0 is regarded as satisfactory for screening (for example in plant breeding), values of and upward are suitable for quality control analysis, and values of above are excellent, ... content of 6% The meal was mixed and then 15 g was removed with a spatula for disk samples and about g for extreme value samples and placed in a sample cup After the samples had been scanned under a ... available and the number of samples used in the calibration and validation sets for all criteria The descriptive statistics for criteria analysed in the laboratory for these powder samples are...

Ngày tải lên: 08/08/2014, 14:20

... Montreal (1990) p [16] Koizumi A. , Takada K., Ueda K., Katayose T., Radial growth and wood quality of plus trees of Japanese larch I Radial growth, density, trunk modulus of elasticity of grafted ... Mokuzai Gakkaishi 36, (1990) 98-102 [17] Koizumi A. , Takada K., Ueda K., Radial growth and wood quality of plus trees of Japanese larch II Diameters at breast heights and trunk moduli of elasticity ... moment and the radius of curvature are constant Determination of this radius R, allows to calculate the MOE of the sample according to the force applied, the shape of the beam and the distances...

Ngày tải lên: 08/08/2014, 14:22

... each well using multiple bead sets detecting the same antigens A set of at plates of identical sera with several identical assays was done against 32 wells × assays per plate Prepare enough of ... like to acknowledge Joann Yee and the California Primate Research Paul Luciw is thanked for use of laboratory facilities; Resmi Page of (page number not for citation purposes) Journal of Negative ... (Center for Comparative Medicine) and the Bioplex machine at CNPRC (California National Primate Research Center) Standard protocol for incubation, washing, and PE placement Acknowledgements The author...

Ngày tải lên: 11/08/2014, 08:20

... Genomic organization of arrayed viruses Genomic organization of arrayed viruses Locations and direction of transcription of each open reading frame of the arrayed viral genomes are shown Red arrows ... Mukai T, Nakano K, Kagawa M, Chen J, Mori Y, Sunagawa T, Kawanishi K, Sashihara J, Hata A, Zou P, Kosuge H, Yamanishi K: Comparison of the complete DNA sequences of human herpesvirus variants A ... and adjusted Cy5 intensities as technical replicates and calculated the mean of these values The ratio of this mean on the average of the intensity across the array set was then obtained A ratio...

Ngày tải lên: 13/08/2014, 13:20

... specification was used as a guide to the possible range of diameters for this heuristics based calculation The specification lacks a sigma multiple In manufacturing, a standard high level target for ... the amount of stochastic variance of this type of assay system, and improve the precision of these assays Provision of accurate mean size, median size, skew and sigma multiple for the size range ... mean diameter Figure Histogram of a representative sample of events for one classifier from an event set Histogram of a representative sample of events for one classifier from an event set Classifier...

Ngày tải lên: 13/08/2014, 16:21