a novel adaptative image segmentation approach

... eye-blink artifact and a white Gaussian distributed signal as the background brain activity have been synthetically mixed The mixing matrix A (generated randomly from a standardized normal distribution) ... provides similar results as to SCBSS eye-blink is attenuated while propagating from frontal to central and occipital areas of the brain In our approach, the multichannel EEG data are transformed ... 73–82, 1997 [10] K Nazarpour, S Sanei, and J A Chambers, A novel semiblind signal extraction approach incorporating PARAFAC for the removal of the removal of eye-blink artifact from EEGs,” in...

Ngày tải lên: 21/06/2014, 22:20

... data Since the test data tend to have a similar error rate to the narrow standard deviation, we computed the overall performance over the average word spacing error rate, which is 9.1% The baseline ... data and randomly insert spacing errors from 0% to 20% in the same way in which we made the development data We feel that this strategy can model both the intentional and un-intentional human ... using the relative frequency information of the training data, and a smoothing technique is applied to relieve the datasparseness problem which is the linear interpolation of n-grams that are used...

Ngày tải lên: 17/03/2014, 02:20

... reasonable to conclude that kernel-based especially tree-kernel approaches are not suitable for Chinese, at least at current stage In this paper, we study a feature-based approach that basically ... incorporated the base phrase chunking information and semi-automatically collected country name list and personal relative trigger word list Jiang and Zhai (2007) then systematically explored a large ... three coarser structures , i.e nested, adjacent and separated, are used as feature, and a classifier is trained for each relation type and subtype; (2) similar to (1) but all nine structures are...

Ngày tải lên: 20/02/2014, 09:20

... and (D) annexin A1 The migration positions of molecular mass standards and protein loading amounts are indicated IEF ⁄ SDS ⁄ PAGE-based investigation, a commercially available colloidal Coomassie ... (release 48.8) with fixed carbamidomethyl modification of cysteine residues, variable oxidation of methionine and variable deamidation of asparagine and glutamine Parent and fragment mass tolerances ... Kristiansen TZ, Jonnalagadda CK, Surendranath V, Niranjan V, Muthusamy B, Gandhi TK, Gronborg M et al (2003) Development of human protein reference database as an initial platform for approaching systems...

Ngày tải lên: 07/03/2014, 06:20

... L9 [2] H Sahaf, L Masson, C Leandri, B Auffray, G Le Lay, F Ronci, Appl Phys Lett 90 (2007) 263110 [3] M .A Valbuena, J Avila, M.E Davila, C Leandri, B Aufray, G Le Lay, M.C Asensio, Appl Surf ... filled states STM images of the surface following the evaporation of Å of THAP are displayed in Fig 3a and b Each molecule appears as a six-pronged shape with six bright lobes and a dark center The ... nice, clean and well characterized THAP monolayers [10,11] The PQ molecules, purchased from Sigma–Aldrich, were loaded under nitrogen atmosphere in a glass ampoule connected to a UHV leak valve This...

Ngày tải lên: 16/03/2014, 15:35

... Both end-plate potentials of the ion trap were set at 1.5 V and the duration of the electron pulse was 100 ms Data acquisition and handling Primary data analysis was performed on a workstation running ... Chrisler, W.B., Thrall, B.D & Smith, R.D (2001) Quantitative analysis of bacterial and mammalian proteomes using a combination of cysteine a nity tags and 15N-metabolic labeling Anal Chem 73, 2132–2139 ... were maintained in accordance with the National Institutes of Health Guide for the care and use of Laboratory Animals All experiments were approved by the regional ethical committee for animal research...

Ngày tải lên: 17/03/2014, 10:20

... information retrieval are based on the statistic method We propose an approach that changes the basic index term weighting method by considering semantics and concepts of a document In this approach, ... information ratio rather than information quantity as the semantic weight of indexes This approach has an advantage in that we need not consider document length when indexing because the overall text ... normalized as an average The results of manually extracted index terms and their weights are given in Table The index term weight and the relevance score are obtained by averaging the individual...

Ngày tải lên: 23/03/2014, 19:20

... Adaptive example-based super-resolution using Kernel PCA with a novel classification approach Takahiro Ogawa∗1 and Miki Haseyama1 Graduate School of Information Science and Technology, Hokkaido ... face images and fingerprint images However, since the global approach requires the assumption that all of the training images are in the same class, it is difficult to apply it to arbitrary images ... expanding a given image based on an interpolator which is trained in advance with training data by using sparse Bayesian estimation [12] This method is not based on PCA and KPCA, but calculates...

Ngày tải lên: 18/06/2014, 22:20

... motif- AAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEA NSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAA SGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ SNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEK ... GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ PEVEKPQKKP TEQGGGGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAA APAAQPEVEKPQKKPVIKPL Core Arg-Gly-Asp (RGD) motif italicized ... CGGGATCCCGGTTTCTTCTGAGGCTTCTCG CGGGATCCGGTGGCGCAGGCGG 83RGD -(as) 83RGD - (a) CGGGATCCCAGGGGTTTGATCACCGGTTT CGGGATCCACCGAACAGGGCGGGG 3'HVR5-(as) 5'HVR2-(s) GGCATGTAAGAAATATGAGTGTCTGGG CTCACGTATTTGGGCAGGCGCC a antisense,...

Ngày tải lên: 20/06/2014, 01:20

... Adaptive example-based super-resolution using Kernel PCA with a novel classification approach Takahiro Ogawa∗1 and Miki Haseyama1 Graduate School of Information Science and Technology, Hokkaido ... face images and fingerprint images However, since the global approach requires the assumption that all of the training images are in the same class, it is difficult to apply it to arbitrary images ... expanding a given image based on an interpolator which is trained in advance with training data by using sparse Bayesian estimation [12] This method is not based on PCA and KPCA, but calculates...

Ngày tải lên: 20/06/2014, 04:20

... training dataset had only normal traffic because they had unlabeled learning ability In case of G-HMM, G-HMM made a normal behavior model using normal data, and then G-HMM calculated the ML values ... the total number of normal data The false negative rate is defined as the total number of attack data that were incorrectly classified as normal traffic divided by the total number of attack data 7.1 ... datasets, we used attack-free training data for normal behavior modeling, and attack data was used to the construction of anomaly score in Table Moreover, for additional learning procedure and...

Ngày tải lên: 21/06/2014, 05:20

... standard method in the image compression applications In the wavelet compression, the image data is transformed and compressed as a single data object rather than block by block as in a DCT-based ... the least mean square (LMS) sense among all linear orthogonal transforms PCA is a linear orthogonal transform from an m-dimensional space to p-dimensional space, p ≤ m, so that the coordinates ... original data in the new space are uncorrelated and the greatest amount of the variance of the original data is kept by only a few coordinates The principal components can be obtained by solving an...

Ngày tải lên: 21/06/2014, 05:20

... Locator Sensor Attacker S3 L5 L2 Locator Sensor Attacker (a) (b) Figure 1: The attack scenarios in WSN (a) Attacker model in range-based localization; (b) Attacked locators with temporal and spatial ... localization process and marks itself a state after the localization The sensor marks itself with an attacked state if it detects any attacked locator; otherwise, it marks itself with a safe state ... + dn 3.3 Attack Model In this paper, we consider an adversarial WSN where a pair of colluding attackers can launch a socalled distance-consistent spoofing attack In [9], the attacker can only revise...

Ngày tải lên: 21/06/2014, 11:20

... body and energy of the X-ray For a monochromatic narrow beam X-ray (which EURASIP Journal on Advances in Signal Processing I0 X-ray I T Figure 1: Attenuation diagram of X-ray imaging law has a single ... than with traditional programming languages such as C and C++ It has a toolbox of image processing which have some traditional image processing functions such as Sobel, Roberts, Prewitt, Laplacian, ... operator, Roberts edge operator, Prewitt edge operator, Laplacian operator, and Canny operator Matlab is a high-level technical computing language We can solve technical computing problems faster...

Ngày tải lên: 21/06/2014, 16:20

... EURASIP Journal on Advances in Signal Processing delay can always be obtained that ranges below the group delay of a corresponding LP FIR filter However, the absolute minimum value of the passband ... minimizes aliasing and imaging The demand for low group delay particularly of the AFB prototype filters has not been asked for explicitly Based on the algorithm [15] the approach [16] introduces additional ... overall single-input single-output (SISO) transfer function of the filter bank pair that ideally approximates a linear-phase allpass function We show that both the magnitude and the group delay...

Ngày tải lên: 21/06/2014, 19:20

... CASIA-IrisV3, Bath, and Ubiris CASIA-IrisV3 includes three subsets which are labeled as CASIA-IrisV3-Interval, CASIA-IrisV3-Lamp, and CASIA-IrisV3-Twins CASIA-IrisV3 contains a total of 22 051 iris images ... includes EURASIP Journal on Advances in Signal Processing (a) (b) (c) Figure 7: Some samples taken from (a) CASIA-IrisV3 database, (b) Bath database, and (c) Ubiris Version database ×104 8.5 ... 3: Real and imaginary axes and related binary codes Figure 4: Iris features in the real/imaginary plane The features near the axes are more inconsistent than others combining with adequate tangential...

Ngày tải lên: 21/06/2014, 22:20

... directed acyclic graph (DAG) The objective function incorporates several constraints on the available silicon area (hardware capacity), B Knerr et al memory (software capacity), and latency as a timing ... control-oriented functionality (an ARM for the signalling part and a StarCore for the multimedia part) It features several hardware accelerating units (ASICs), for the more data-oriented and computation intensive ... metric κ has been calculated for all the sample graphs, and the performance of GA, TS, and RRES has been plotted against this characteristic value, as shown in Figure 11 The Ω values are normalised...

Ngày tải lên: 22/06/2014, 06:20

... validation gate of size 28 × 28, and so forth It is obvious that with such a large validation gate and a large number of targets, the data association problem is very crucial and needs an efficient ... and Data Association, Academic Press, San Diego, Calif, USA, 1988 [2] S Blackman and R Popoli, Design and Analysis of Modern Tracking Systems, Artech House, Boston, Mass, USA, 1999 [3] J B Pearson ... that the parameters for the tracking filters are set to the same value as those set for the clips with few targets These parameters are process noise variance, observation noise variance and validation...

Ngày tải lên: 22/06/2014, 19:20

... person and the ratio HF /WE vary in the range 1.1–1.3 Several face images, about 450, were manually cropped from images captured in our lab and an average of all these face images forms an average ... Gaussian [2] A large data base of labelled skin pixels of several people both male and female has been used to build the Gaussian model The mean and the covariance of the database characterize ... recognize a face The face localization and segmentation stage takes an average of 0.04 seconds The face recognition stage takes 0.02 seconds to recognize a segmented face The face segmentation algorithm...

Ngày tải lên: 22/06/2014, 20:20