a new paradigm for microbe associated disease

Báo cáo y học: " Relational grounding facilitates development of scientifically useful multiscale models" ppsx

Báo cáo y học: " Relational grounding facilitates development of scientifically useful multiscale models" ppsx

... scales of organization A research goal (Goal 1) for computational biology, translational research, quantitative pharmacology, and other biomedical domains involves discovering and validating causal ... recommendation based on Example Two As a general guideline, when quantitative validation data are not available, it is most reasonable to first build a qualitative, relational model, and then qualitatively ... offer a general guideline When validation data are not available, it is most reasonable to first build a qualitative, relational model, and then qualitatively validate and make predictions that...

Ngày tải lên: 13/08/2014, 16:20

23 252 0
Five stories that are almost true, but not quite

Five stories that are almost true, but not quite

... in shape because she was a classical dancer for a time and later became a fashion model She was cheery, always with a funny story or incident to relate and at all times fun to have around When ... industrialization, an exploding birth rate and later on, an Islamic renaissance with its attendant religious radicalism and fanaticism One must be clear: this romance was for the few Mainly tourists, ... black coat over that All with an impeccable fit What made me unable to take my eyes off her was the fantastic way she was made up “You are a modern-day Cleopatra!” “Thank you It's my Moni He made...

Ngày tải lên: 06/11/2012, 17:33

11 460 0
Corporate Culture The Four Ingredients That Are Crucial to Your Company’s Success

Corporate Culture The Four Ingredients That Are Crucial to Your Company’s Success

... crisis are within accepted norms Picture a case where a manager, Susan, has reached an important junction in her project Two alternatives are available and both are logical, practical, and make ... demonstrate professional management and expert leadership Key to his actions was to put profit into the value statements and strategic goals He also began to communicate the actual financial situation ... One reason I believe it was so popular was that when the final crisis was faced, Captain Kirk and his team always prevailed over technology or adversity The subtle message was that the human spirit...

Ngày tải lên: 24/10/2013, 09:20

34 530 0
Tài liệu Edit Data and Update Changes That Are Made to an ADO.NET pdf

Tài liệu Edit Data and Update Changes That Are Made to an ADO.NET pdf

... is created to create the Update command for the DataAdapter object The DataAdapter Update method is called to update the dataset with the data changed and then the AcceptChanges of the DataSet ... Create the LoadList routine by entering the following code into the form you created for this How-To This code creates and fills a data table using a data adapter The string that the data adapter ... the form Dim mdsCustIndiv As New DataSet() Dim modaCustIndiv As OleDb.OleDbDataAdapter Dim mdrCustIndiv As DataRow Enter the following code as the Click event for btnLoadList: Private Sub btnLoadList_Click(ByVal...

Ngày tải lên: 24/12/2013, 06:17

10 400 0
Tài liệu Objects That Are Found in ADO.NET doc

Tài liệu Objects That Are Found in ADO.NET doc

... data Each data table has a default view, which is the starting data view that can be modified and stored in a separate data view DataRow This object enables you to manipulate the rows of data ... results that are returned by commands and the data adapters Unlike the recordset from ADO and DAO, the data set actually brings back a hierarchical view of the data Using properties and collections ... statements to update data back at the server DataColumn As the name suggests, you can get information at the column level by using the DataColumn object You can get schema information as well as...

Ngày tải lên: 24/12/2013, 06:17

5 325 0
Tài liệu Báo cáo khoa học: Analysis of oxidative events induced by expanded polyglutamine huntingtin exon 1 that are differentially restored by expression of heat shock proteins or treatment with an antioxidant ppt

Tài liệu Báo cáo khoa học: Analysis of oxidative events induced by expanded polyglutamine huntingtin exon 1 that are differentially restored by expression of heat shock proteins or treatment with an antioxidant ppt

... from Dalhousie University, Halifax, Canada and held a CIHR ⁄ CNRS International Scientific Exchange Scholarship from the Canadian Institutes of Health Research and the Centre National de la Recherche ... Japan) Images were recorded with a MegaviewII numeric camera, and analysis software (Soft Imaging System GmbH, Munster, Germany) ¨ was used to analyze the images Determination of intracellular ... was then analyzed according to the manufacturer’s instructions Absorbance was read on a Dynatech MR5000 microplate reader (Dynatech, Chantilly, VA, USA) at 540 nm with a reference wavelength...

Ngày tải lên: 19/02/2014, 06:20

18 721 0
Tài liệu Báo cáo khoa học: Transactivation properties of c-Myb are critically dependent on two SUMO-1 acceptor sites that are conjugated in a PIASy enhanced manner pptx

Tài liệu Báo cáo khoa học: Transactivation properties of c-Myb are critically dependent on two SUMO-1 acceptor sites that are conjugated in a PIASy enhanced manner pptx

... determination of reporter activation using both a 5-bromo-4-chlorindol-3-yl b-D-galactoside overlay and a liquid b-galactosidase assay (Fig 3) Similar analysis of several subdomains of c-Myb revealed ... sumoylation and desumoylation are needed for viability in yeast [27] Because several different classes of proteins are targets for SUMO-1 conjugation, it is rather unlikely that a single explanation ... evidence for a double helix-turn-helixrelated motif Science 253, 1140–1143 Tahirov, T.H., Sato, K., Ichikawa-Iwata, E., Sasaki, M., InoueBungo, T., Shiina, M., Kimura, K., Takata, S., Fujikawa, A. ,...

Ngày tải lên: 21/02/2014, 00:20

11 557 0
Default Risk Cannot Explain the Muni Puzzle: Evidence from Municipal Bonds That Are Secured by U.S. Treasury Obligations ppt

Default Risk Cannot Explain the Muni Puzzle: Evidence from Municipal Bonds That Are Secured by U.S. Treasury Obligations ppt

... Risks are similar (ii) Bonds are not callable, so the maturity date and maturity price are certain (iii) Liquidity and transaction costs are similar (iv) Federal tax applies to one bond and tax payments ... for taxable and tax-exempt bonds The premium over par paid for a taxable bond may be amortized and taken as an annual tax deductible loss over the life of the bond.11 While the purchaser of a ... maturities as well as the average state corporate and personal tax rates applicable to the bonds in the sample Note that the average corporate state tax rate is 4.95% This gives an indication of...

Ngày tải lên: 15/03/2014, 03:20

28 591 0
Báo cáo khoa học: Cytosolic phospholipase A2-a and cyclooxygenase-2 localize to intracellular membranes of EA.hy.926 endothelial cells that are distinct from the endoplasmic reticulum and the Golgi apparatus pdf

Báo cáo khoa học: Cytosolic phospholipase A2-a and cyclooxygenase-2 localize to intracellular membranes of EA.hy.926 endothelial cells that are distinct from the endoplasmic reticulum and the Golgi apparatus pdf

... studies demonstrated that this interaction was necessary for cPLA2 -a- mediated arachidonic acid release, and suggested that vimentin may function as an adapter protein for FEBS Journal 272 (2005) ... cPLA2 -a and convert arachidonic acid into prostaglandin H2 [8,9] To date, two distinct COX isoforms, COX-1 and COX-2, have been identified and characterized, and an alternative splice variant ... cPLA2 -a have suggested that accessory or binding proteins may play a role in the regulation of cPLA2 -a activity and localization Annexin V, for example, has been shown to exhibit similar membrane...

Ngày tải lên: 16/03/2014, 18:20

13 388 0
Easy Recipes that are Gluten-Fre pptx

Easy Recipes that are Gluten-Fre pptx

... with a medium cutter, or chop as small as you can Season with salt, pepper, vinegar and brandy Mix well and leave to stand for hours Add egg and basil to the mixed meat and mix well Spoon into a ... cups water Wash rice and drain Mix mushrooms, onions, garlic, gluten-free soy sauce, oil and sesame seeds, salt and pepper Fry mixture for minutes in a large pan Add rice, vegetables and water and ... brown Traditional stuffing is sage and onion (not suitable for gluten-free or low-carb diets) Alternatively use apricot and rice stuffing Traditionally accompanied by a sweet sauce, such as apple,...

Ngày tải lên: 17/03/2014, 16:20

25 940 0
Authoring and Generating Health-Education Documents That Are Tailored to the Needs of the Individual Patient doc

Authoring and Generating Health-Education Documents That Are Tailored to the Needs of the Individual Patient doc

... realization stage, which uses KPML (Bateman, 1995), a descendant of Penman, to generate an appropriate surface form in English A formatter then lays out the text attractively and adds headings and ... that this was relevant to the particular patient Representing a Tailorable Document 3.1 Finding an Appropriate Level of Abstraction As explained above, a master document is a specification of all ... Proceedings, ECAI-96 Workshop ‘Gaps and Bridges’: New Directions in Planning and Natural Language Generation, Budapest, August 1996 Maibach, E and Parrott, R.L (1995) Designing health messages: Approaches...

Ngày tải lên: 22/03/2014, 15:21

12 379 0
Báo cáo khoa học: A profile of the residues in the second extracellular loop that are critical for ligand recognition of human prostacyclin receptor pdf

Báo cáo khoa học: A profile of the residues in the second extracellular loop that are critical for ligand recognition of human prostacyclin receptor pdf

... purchased from Amersham Pharmacia Biotech (Piscataway, NJ, USA) DNA polymerase and DpnI endonuclease were obtained from Stratagene (La Jolla, CA, USA) Rabbit anti-(human IP) serum was purchased ... 5¢-AAGAATTCA CAGGGTCAGCTTGAAATGTCAG-3¢ (reverse), with XhoI and EcoRI sites on the ends The full-length cDNA of IP was obtained from standard PCR amplification, which was performed in a 50 lL reaction ... 264, 16496–16501 Hirata M, Hayashi Y, Ushikubi F, Yokata Y, Kageyama R, Nakanishi S & Narumiya S (1991) Cloning and expression of cDNA for a human thromboxane A2 receptor Nature 349, 617–620 10...

Ngày tải lên: 23/03/2014, 07:20

10 354 0
Chapter 2Communicating Over the Network Quangkien@gmail.com.OverviewDescribe the structure of a network, including the devices and media that are necessary for successful communications. Explain the function of protocols in network communications. Ex potx

Chapter 2Communicating Over the Network Quangkien@gmail.com.OverviewDescribe the structure of a network, including the devices and media that are necessary for successful communications. Explain the function of protocols in network communications. Ex potx

... Frame Header IP Header Data App TCP Header Header Frame Trailer Data Message: Data Multiple protocols 26 Multiple protocols (encapsulated) HTTP Header Protocols Frame Header IP Header Data App TCP ... The amount of data and the speed at which it must be transmitted – The cost of the media and installation 17 Local Area Network (LAN) Local Area Network (LAN) An individual network usually spans ... encapsulations Data Link Header IP Header TCP Header HTTP Header Data Data Link Trailer The receiving host receives the message with multiple decapsulations Data Link Header IP Header TCP Header...

Ngày tải lên: 01/04/2014, 12:20

52 550 0
Chapter 3: Financial Audit Receivables and Payables Activities between funds that are ppt

Chapter 3: Financial Audit Receivables and Payables Activities between funds that are ppt

... judgments against the State, and would have to be paid by legislative appropriation of the state general fund and not by the department Ceded Land The Office of Hawaiian Affairs (OHA) and the State are ... 173,679,476 Chapter 3: Financial Audit Note – Capital Assets Capital asset activity for the year ended June 30, 2003 was as follows: Beginning Balance Governmental activities: Capital assets not ... Chapter 3: Financial Audit executed but unperformed purchase orders or contracts Encumbrances are recorded as expenditures for budgetary purposes and as reservations of fund balance for GAAP...

Ngày tải lên: 18/06/2014, 20:20

10 277 0
Báo cáo toán học: "On identifying codes in the king grid that are robust against edge deletions" potx

Báo cáo toán học: "On identifying codes in the king grid that are robust against edge deletions" potx

... adjacent if their Euclidean distance is at most The king grid is a mathematically attractive model, because a ball of radius r has a particularly simple form, being a (2r + 1) × (2r + 1) square ... that in average, each frame contains at least three codewords For that purpose, we devise a counting scheme which shows how the frames with only two codewords can be averaged out We ask the frames ... horizontal line in the array Lemma Each frame in F2 gets at least one vote in all Proof Without loss of generality, we can assume that F (i, j) ∈ F2 , and that the two non-codewords in F (i, j) are...

Ngày tải lên: 07/08/2014, 15:22

13 213 0
Báo cáo y học: " Strand-specific RNA sequencing reveals extensive regulated long antisense transcripts that are conserved across yeast specie" ppt

Báo cáo y học: " Strand-specific RNA sequencing reveals extensive regulated long antisense transcripts that are conserved across yeast specie" ppt

... GTAAAAGTATTTGGCTTCATTAG TGTGTGAAAAATAAAGAAAATAGATACAATACTATCGACGGTCGACGGATCCCCGGGTT and AAGA AAGTATATAAAATCTCTCTATATTATACAGGCTACTTCTTTTAGGAAACGTCACATCGATGAATTCGAGCTCGTT [32] Correct integration ... (Qiagen - Valencia, CA, USA) and 500 ng of total RNA Each reaction was carried out at 50°C for 20 minutes, and heat inactivated at 70°C for 15 minutes PCR was conducted as for the S cerevisiae RT-PCR ... cerevisiae BY4741 Same as above with rrp6Δ::KANMX6 ATCC Saccharomyces cerevisiae BY4741 Same as above with hda2Δ::URA3 Gift from Oliver Rando’s lab Saccharomyces cerevisiae BY4741 Same as above...

Ngày tải lên: 09/08/2014, 20:22

14 339 0
Báo cáo y học: "APOBEC3G induces a hypermutation gradient: purifying selection at multiple steps during HIV-1 replication results in levels of G-to-A mutations that are high in DNA, intermediate in cellular viral RNA, and low in virion RNA" pps

Báo cáo y học: "APOBEC3G induces a hypermutation gradient: purifying selection at multiple steps during HIV-1 replication results in levels of G-to-A mutations that are high in DNA, intermediate in cellular viral RNA, and low in virion RNA" pps

... C-terminal portion of Vif was amplified using the forward primer YRHHYmutF, 5'GGAAAGCTAAGGACTGGT TTGCTGCAGCTGCCGCTGAAAGTACTAATCCAAAAATA AG3', and the reverse primer VifR, 5'GGATAAACAGCAGT TGTTGC3' ... A5 The forward primer VifF, 5'CAGGGAGATTCTAAAAG3', and the reverse primer YRHHYmutR, 5'CTTATTTTTGGATTAGTAC TTTCAGCGGCAGCTGCAGCAAACCAGTCCTTAGCTTTC C3', were used to amplify the N-terminal region ... (5'GTCTGTTGTGTGACTCTGGTAAC3') and DIS-R (5'CCTGTCTGAAGGGATGGTTGTAG3') RNA extraction, DNase treatment, and RT-PCR Viral RNA was extracted using the QIAamp viral RNA mini kit (Qiagen) Briefly, a 140 μl aliquot...

Ngày tải lên: 13/08/2014, 05:21

15 320 0
Báo cáo y học: " Amino acid residues that are important for Hyal2 function as a receptor for jaagsiekte sheep retrovirus" potx

Báo cáo y học: " Amino acid residues that are important for Hyal2 function as a receptor for jaagsiekte sheep retrovirus" potx

... LQTHFRCQCYLGWGGEQCQWDRRRAAGGASGAWAGSHLTGLLAVAVLAFTWTS LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGSHLTSLLALAALAFTWTL LQKHFRCQCYLGWGGEQCQRNYKGAAGNASRAWAGSHLTSLLGLVAVALTWTL LQMHFRCHCYLGWGGEQCQWNHKRAAGDASRAWAGAHLASLLGLVAMTLTWTL ... LWAESTALFPSVYLEETLASSTHGRNFVSFRVQEALRVADVHHANHALPVYVFTRPTYSR LWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVARTHHANHALPVYVFTRPTYSR LWAESTALFPSVYLDETLASSVHSRNFVSFRVREALRVAHTHHANHALPVYVFTRPTYTR LWAESTALFPSVYLDETLASSKHSRNFVSFRVQEALRVAHTHHANHALPVYVFTRPTYTR ... from that of human Hyal2 We also made a human Hyal2 mutant that contained all three of these mutations, and this mutant had 6% of the activity of human Hyal2 (average of two experiments, data not...

Ngày tải lên: 13/08/2014, 09:21

11 247 0
Báo cáo sinh học: "Genetic diversity of selected genes that are potentially economically important in feral sheep of New Zealand" pot

Báo cáo sinh học: "Genetic diversity of selected genes that are potentially economically important in feral sheep of New Zealand" pot

... alleles identified (n) and allele frequencies for KRTAP1-1, KRT33 and ADRB3 KRTAP1-1 Population N n A B C Arapawa Island I 14 0.4 3a 0.4 6a 0.11bc Arapawa Island II Chatham Island 59 22 2 0.18ab ... Island for KRTAP1-1 and among the Arapawa II flock of feral sheep for KRT33 and lower among the Arapawa I flock for DQA2 Finally, allele sharing among sheep from Woodstock was very low for DQA2 ... (n) and allele frequencies for DQA21 DQA2 alleles Population N n 06023 0601 08011 0901 0103 1101 01021601 01011401 1201 Arapawa Island I 17 0.1 8a - 0.1 5a - 0.0 6a 0.0 6a - - 0.0 3a a a a a Arapawa...

Ngày tải lên: 14/08/2014, 13:21

8 275 0
Báo cáo y học: "Summary The claudin multigene family encodes tetraspan membrane proteins that are crucial structural and functional components of tight junctions, which have important roles in regulating para­ cellular" pdf

Báo cáo y học: "Summary The claudin multigene family encodes tetraspan membrane proteins that are crucial structural and functional components of tight junctions, which have important roles in regulating para­ cellular" pdf

... ovarian cancer cells Exp Cell Res 2007, 313:3364-3375 43 Yamauchi K, Rai T, Kobayashi K, Sohara E, Suzuki T, Itoh T, Suda S, Hayama A, Sasaki S, Uchida S: Disease- causing mutant WNK4 increases ... variants documented in GenBank are indicated and other variants may exist serve as a continuous paracellular seal between the apical and basolateral sections [1,21] When observed by freezefracture ... cochlear hair cell degeneration Hum Mol Genet 2003, 12:2049-2061 30 Miyamoto T, Morita K, Takemoto D, Takeuchi K, Kitano Y, Miyakawa T, Nakayama K, Okamura Y, Sasaki H, Miyachi Y, Furuse M, Tsukita...

Ngày tải lên: 14/08/2014, 21:20

7 348 0
w