Báo cáo khoa học: "A Modular Open-Source System for Recognizing Textual Entailment" pot

Báo cáo khoa học: "A Modular Open-Source System for Recognizing Textual Entailment" pot

Ngày tải lên : 07/03/2014, 18:20
... Department Bar-Ilan University Ramat-Gan 52900, Israel dagan@cs.biu.ac.il Abstract This paper introduces BIUTEE 1 , an open- source system for recognizing textual entail- ment. Its main advantages are its ability ... Open- Source System for Recognizing Textual Entailment Asher Stern Computer Science Department Bar-Ilan University Ramat-Gan 52900, Israel astern7@gmail.com Ido Dagan Computer Science Department Bar-Ilan ... encourage researchers to create and share their textual- inference components. A good example from another research area is the Moses system for Statistical Machine Transla- tion (SMT) (Koehn et al.,...
6 414 0
Báo cáo khoa học: "An Open-Source Package for Recognizing Textual Entailment" pdf

Báo cáo khoa học: "An Open-Source Package for Recognizing Textual Entailment" pdf

Ngày tải lên : 17/03/2014, 00:20
... Malakasiotis and Ion Androutsopoulos 2007. Learning Textual Entailment using SVMs and String Similarity Measures. Proc. of the ACL ’07 Workshop on Textual Entailment and Paraphrasing. Ido Dagan ... regards the RTE Challenges, in the last years EDITS has been used to participate both in the PASCAL/TAC RTE Campaigns for the En- glish language (Mehdad et al., 2009), and in the EVALITA RTE task ... H. Similarity algorithms are adapted to the ED- ITS distance framework by transforming measures of the lexical/semantic similarity between T and H into distance measures. These algorithms are also adapted...
6 358 0
Tài liệu Báo cáo khoa học: "Types of Common-Sense Knowledge Needed for Recognizing Textual Entailment" ppt

Tài liệu Báo cáo khoa học: "Types of Common-Sense Knowledge Needed for Recognizing Textual Entailment" ppt

Ngày tải lên : 20/02/2014, 05:20
... the ACL-PASCAL Workshop on Textual Entailment and Paraphrasing, RTE ’07, pages 54–59, Morristown, NJ, USA. Association for Com- putational Linguistics. 333 #56 - ENTAILMENT T: (CNN) Nadya Suleman, ... An Elec- tronic Lexical Database. Bradford Books. R.V. Guha and D.B. Lenat. 1990. Cyc: a mid-term re- port. AI Magazine, 11(3). V. Vydiswaran M. Sammons and D. Roth. 2010. Ask not what textual ... not: A case study using functional relations. In Empirical Methods in Natural Language Processing. Dan Roth and Mark Sammons. 2007. Semantic and log- ical inference model for textual entailment. ...
6 512 0
Tài liệu Báo cáo khoa học: "A Logic-based Semantic Approach to Recognizing Textual Entailment" ppt

Tài liệu Báo cáo khoa học: "A Logic-based Semantic Approach to Recognizing Textual Entailment" ppt

Ngày tải lên : 20/02/2014, 12:20
... 2006. c 2006 Association for Computational Linguistics A Logic-based Semantic Approach to Recognizing Textual Entailment Marta Tatu and Dan Moldovan Language Computer Corporation Richardson, Texas, 75080 United ... 71.89 66.66 Table 3: RTE 2005 data results (accuracy, confidence-weighted score, and f-measure for the true class) Task COGEX COGEX LEXALIGN COMBINATION acc ap f acc ap f acc ap f acc ap f IE 58.00 ... data. It outperforms the semantic systems on the 2005 QA test data, but it has its limitations. The logic rep- resentations are generated from parse trees which are not always accurate ( 86% accuracy)....
8 440 0
Tài liệu A Hybrid Neural Fuzzy System for Statistical Process Control docx

Tài liệu A Hybrid Neural Fuzzy System for Statistical Process Control docx

Ngày tải lên : 23/01/2014, 01:20
... work for various applications, data transformation is necessary to standardize the raw data into the value range that both neural network components can work with. Formulas for data transformation ... Tables 18.6 (a) and (b), to Acosta and Pignatiello’s (1996) EWMA chart which adopts Roberts’ (1959) EWMA for mean and Wortham’s and Heinrich’s (1972) EWMA for variance. To obtain a fair comparison, ... operations, etc. A QC can be mathematically defined as a random variable, which is a function that takes values from a population or distribution. Denote a QC as random variable x . If a population...
22 716 1
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Ngày tải lên : 18/02/2014, 08:20
... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335 E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... DNA poly- merase was purchased from Toyobo (Osaka, Japan). Emul- gen 911 was a gift from Kao Chemical (Tokyo, Japan). NADPH, NADH and NADP + were purchased from Oriental Yeast (Tokyo, Japan). a- Cyano-4-hydroxycinnamic acid ... T m value of each protein at neutral pH. a Data from this study. b Data from Griffin et al. [32]. c Data from Yano et al. [4]. T. Mandai et al. Thermostable electron transport system FEBS Journal...
14 617 0
Tài liệu Báo cáo khoa học: "An Open Source Toolkit for Phrase-based and Syntax-based Machine Translation" docx

Tài liệu Báo cáo khoa học: "An Open Source Toolkit for Phrase-based and Syntax-based Machine Translation" docx

Ngày tải lên : 19/02/2014, 20:20
... {zhanghao1216,liqiangneu}@gmail.com Abstract We present a new open source toolkit for phrase-based and syntax-based machine translation. The toolkit supports several state-of-the-art ... Phrasal: A Toolkit for Statistical Machine Translation with Facilities for Extraction and Incorporation of Arbitrary Model Features. In Proc. of HLT/NAACL 2010 demonstration Session, pages ... Chris Callison-Burch, Chris Dyer, Sanjeev Khudanpur, Lane Schwartz, Wren Thornton, Jonathan Weese, and Omar Zaidan. 2009. Joshua: An Open Source Toolkit for Parsing-Based Machine Translation....
6 531 0
Tài liệu Báo cáo khoa học: "MemeTube: A Sentiment-based Audiovisual System for Analyzing and Displaying Microblog Messages" pdf

Tài liệu Báo cáo khoa học: "MemeTube: A Sentiment-based Audiovisual System for Analyzing and Displaying Microblog Messages" pdf

Ngày tải lên : 20/02/2014, 05:20
... We also integrate the sentiment-detection system with a real-time rule-based harmonic music and animation generator to display streams of messages in an audiovisual format.  Conceptually, ... generating music melody au- tomatically based on detected sentiments, and (3) produce an animation of real-time piano playing for audiovisual display. Our MemeTube system can be accessed via: ... In recent years, a number of studies have inves- tigated integrating emotions and music in certain media applications. For example, Ishizuka and Onisawa (2006) generated variations of theme...
6 449 0
Báo cáo khoa học: "A Broad-Coverage Normalization System for Social Media Language" pot

Báo cáo khoa học: "A Broad-Coverage Normalization System for Social Media Language" pot

Ngày tải lên : 07/03/2014, 18:20
... informal writing style and the conversational nature. The social text serves as a very valuable information source for many NLP ap- plications, such as the information extraction (Ritter et al., ... word-coverage across all data sets and the broad word-coverage can be successfully translated into message-level perfor- mance gain. We observe that the social media is an emotion-rich language, therefore ... word-coverage across all data sets (a 10% absolute increase compared to state-of- the-art); the broad word-coverage can also successfully translate into message-level per- formance gain, yielding 6% absolute...
10 845 0
Báo cáo khoa học: "Methods for Using Textual Entailment in Open-Domain Question Answering" doc

Báo cáo khoa học: "Methods for Using Textual Entailment in Open-Domain Question Answering" doc

Ngày tải lên : 08/03/2014, 02:21
... paraphrases are generally assumed to contain information about the same event, these approaches have generally assumed that all of the available paraphrases for a given sentence will include at ... Fortieth Annual Meeting of the Association for Computational Linguistics (ACL), Philadelphia, PA. Dan Moldovan, Marius Pasca, Sanda Harabagiu, and Mihai Surdeanu. 2002. Performance Issues and Er- ror ... Harabagiu, Dan Moldovan, Marius Pasca, Rada Mihalcea, Mihai Surdeanu, Razvan Bunsecu, Rox- ana Girju, Vasile Rus, and Paul Morarescu. 2001. The Role of Lexico-Semantic Feedback in Open- Domain...
8 535 0
Báo cáo khoa học: "An Open Source Toolkit for Tree/Forest-Based Statistical Machine Translation" ppt

Báo cáo khoa học: "An Open Source Toolkit for Tree/Forest-Based Statistical Machine Translation" ppt

Ngày tải lên : 16/03/2014, 20:20
... Asia wuxianchao@gmail.com,takuya-matsuzaki@nii.ac.jp,jtsujii@microsoft.com Abstract We describe Akamon, an open source toolkit for tree and forest-based statistical machine translation (Liu et al., 2006; ... Toolkit for Tree/Forest-Based Statistical Machine Translation ∗ Xianchao Wu † , Takuya Matsuzaki ∗ , Jun’ichi Tsujii ‡ † Baidu Inc. ∗ National Institute of Informatics ‡ Microsoft Research Asia wuxianchao@gmail.com,takuya-matsuzaki@nii.ac.jp,jtsujii@microsoft.com Abstract We ... Normalized Kendall’s τ as proposed by (Isozaki et al., 201 0a) to automatically evaluate the translation between distant language pairs based on rank correlation coefficients and significantly penal- 2 Code...
6 347 0
Báo cáo khoa học: "The S-Space Package: An Open Source Package for Word Space Models" pdf

Báo cáo khoa học: "The S-Space Package: An Open Source Package for Word Space Models" pdf

Ngày tải lên : 17/03/2014, 00:20
... Probabilis- tic Approaches to Natural Language, pages 61–65. AAAI Press. Zellig Harris. 1968. Mathematical Structures of Lan- guage. Wiley, New York. Mario Jarmasz and Stan Szpakowicz. 2003. Roget’s thesaurus ... models, which facilitates word space based applications. The package is written in Java and defines a standardized Java interface for word space algo- rithms. While other word space frameworks ex- ist, ... such as information retrieval, natu- ral language processing and cognitive psychology. For a recent survey of word space approaches and applications, see (Turney and Pantel, 2010). The parallel...
6 410 0
Báo cáo khoa học: "A Multi-Document Summarization System for Scientific Article" docx

Báo cáo khoa học: "A Multi-Document Summarization System for Scientific Article" docx

Ngày tải lên : 17/03/2014, 00:20
... , Giles C. L. and Kan M. 2008. ParsCit: An open- source CRF reference string parsing pack- age INTERNATIONAL LANGUAGE RESOURCES AND EVALUATION European Language Resources Association Edmundson, ... summary generated for a set of related scientific articles. This behaviour is different from some other non-interactive summa- rization systems that might appear as a black box and might not tailor ... Work Surprisingly, not many approaches to the problem of summarization of scientific articles have been pro- posed in the past. Qazvinian et al. (2008) present a summarization approach that can be seen as the converse...
6 343 0
Báo cáo khoa học: "Demonstration of Joshua: An Open Source Toolkit for Parsing-based Machine Translation" potx

Báo cáo khoa học: "Demonstration of Joshua: An Open Source Toolkit for Parsing-based Machine Translation" potx

Ngày tải lên : 17/03/2014, 02:20
... Jonathan Weese, and Omar Zaidan. 200 9a. Joshua: An open source toolkit for parsing- based machine translation. In Proceedings of the Fourth Workshop on Statistical Machine Transla- tion, pages ... modelling for statistical machine transla- tion. In Proceedings of ACL. Omar F. Zaidan. 2009. Z-MERT: A fully configurable open source tool for minimum error rate training of machine translation systems. ... method achieves a 90% reduction in training corpus size while maintaining state-of-the-art performance. • Suffix-array Grammar Extraction: Gram- mars extracted from large training corpora are often...
4 275 0
NiagaraCQ: A Scalable Continuous Query System for Internet Databases ppt

NiagaraCQ: A Scalable Continuous Query System for Internet Databases ppt

Ngày tải lên : 23/03/2014, 03:20
... initial writing of the paper. We are particularly grateful to Ashraf Aboulnaga, Navin Kabra and David Maier for their careful review and helpful comments on the paper. We also thank the anonymous ... (1999). [MD89] D. McCarthy and U. Dayal. The architecture of an active database management system. SIGMOD 1989: 215-224. [RC88] A. Rosenthal and U. S. Chakravarthy. Anatomy of a Modular Multiple Query ... NiagaraCQ can trigger continuous queries. They are data -source change events and timer events. Data sources can be classified into push-based and pull-based. Push-based data sources will inform...
12 425 0

Xem thêm