a hybrid neural fuzzy system for statistical process control

... A Hybrid Neural Fuzzy System for Statistical Process Control 18.1 18.2 18.3 18.4 Shing I Chang Kansas State University Statistical Process Control Neural Network Control Charts A Hybrid Neural ... alternative statistical process control method for monitoring process mean and variance A hybrid neural fuzzy system consists of four modules for data input, data processing, decision making, and data ... first statistical control charts for monitoring process variance changes Johnson and Leone (196 2a, 1962b) and Page (1963) later proposed CUSUM charts based on sample variance and sample range As an...

Ngày tải lên: 23/01/2014, 01:20

... the pollutants concentration was low in the rain season (from May to October) The data from the local weather station showed that the average annual rainfall and evaporation was 802mm and 2093mm, ... order to make full use of the land advantage to strengthen ecological and scenical effect of ecological system The area was 2000 m2 and hydraulic loading rate was 4cm/d in the free-surface constructed ... domestic wastewater in Lake Dianchi Valley., Proceedings of Asian waterqual’2003, IWA Asia-Pacific Regional conference, Abstract on pp 70, Paper on CD-ROM, Bangkok Liu, C.X., Hu, H.-Y., Huang, X.,...

Ngày tải lên: 05/09/2013, 08:40

... translated in a full knowledge of the building graph and a calculation of the shortest paths by using Dijkstra’s algorithm An evacuee becomes aware of a hazardous area when it reaches a location ... hazard A low value indicates that the system has succeeded in directing the evacuees along safe paths, avoiding the hazardous locations • Percentage of fatally injured evacuees This is a straightforward ... building’s structure before the hazard starts spreading We consider that the evacuees are familiar with all the available exits and are able to follow the shortest paths that lead to them In terms...

Ngày tải lên: 07/12/2013, 11:41

... Analysis with Spreadsheets Duxbury Press, Belmont, CA Kleinmuntz, C.E., Kleinmuntz, D.N., 1999 A strategic approach to allocating capital in healthcare organizations Healthcare Financial Management, ... multicriteria value analysis and decision conferencing: A case study International Transactions in Operational Research, 13(4), 279-297 Bana e Costa, C .A. , Lourenço, J.C., Soares, J.O., 2007 An interval ... References Bana e Costa, C .A. , 1990 An additive value function technique with a fuzzy outranking relation for dealing with poor intercriteria preference information In C .A Bana e Costa, ed Readings...

Ngày tải lên: 07/12/2013, 11:41

... 277 283 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK *****::*.** : ... Toyobo (Osaka, Japan) Emulgen 911 was a gift from Kao Chemical (Tokyo, Japan) NADPH, NADH and NADP+ were purchased from Oriental Yeast (Tokyo, Japan) a- Cyano-4-hydroxycinnamic acid was obtained from ... :.:: : * : * NAYTAKAVIIAAGVGAFEPRRIGAPGEREFEGRGVYYAVKSKA-EFQGK-RVLIVGGGDS -EYTCDALIIATGASA -RYLGLPSEEAFKGRGVSACATCDG-FFYRNQKVAVIGGGNT LEVKARTVILAVGSRR -RKLGVPGEAELAGRGVSYCSVCDAPLFKGKDAVVVVGGGDS...

Ngày tải lên: 18/02/2014, 08:20

... We also integrate the sentiment-detection system with a real-time rule-based harmonic music and animation generator to display streams of messages in an audiovisual format  Conceptually, our system ... similar to what many people have proposed for evaluation (Davidov et al 2010; Sun et al 2010; Bifet and Frank 2010; Go et al 2009; Pak and Paroubek 2010; Chen et al 2010) We use data from January ... playing Animation Generation In this final stage, our system produces real-time animation for visualization The streams of messages are designed to flow as if they were playing a piece of a piano...

Ngày tải lên: 20/02/2014, 05:20

... Pradhan, Kadri Hacioglu, Valeri Krugler, Wayne Ward, James H Martin, and Daniel Jurafsky 200 5a Support vector learning for semantic argument classification Machine Learning Journal Nello Cristianini ... PAF 64.38 Linear 68.71 Poly 70.25 Development Test WSJ Test Brown Table 3: Performance (Fβ=1 ) comparison among various kernels Test WSJ Overall A0 A1 A2 A3 A4 A5 AM-ADV AM-CAU AM-DIR AM-DIS AM-EXT ... standard features, we can see that the syntactic features, such as Path, Path Length, bulk large among all features On the other hand, the previous researches (Gildea and Palmer, 2002; Punyakanok...

Ngày tải lên: 20/02/2014, 12:20

... normalization problem was also tackled under the machine transla- tion (MT) or speech recognition (ASR) framework (Aw et al., 2006) adapted a phrase-based MT model for normalizing SMS and achieved ... SMS and Twitter data sets to evaluate the system effectiveness Statistics of these data sets are summarized in Table Data set (1) to (3) are used for word-level evaluation; data set (4) for both ... that the broad-coverage system outperforms all other systems on the reported data sets It achieves about 90% word-level accuracy on data set (1) and (2) with the top-10 candidates (an average...

Ngày tải lên: 07/03/2014, 18:20

... of each step and the final score For each transformation the tool presents the parse tree before and after applying the transformation, highlighting the impact of this transformation In manual ... Semantic inference at the lexicalsyntactic level In Proceedings of AAAI Luisa Bentivogli, Peter Clark, Ido Dagan, Hoa Dang, and Danilo Giampiccolo 2010 The sixth pascal recognizing textual entailment ... Manning 2005 Incorporating non-local information into information extraction systems by gibbs sampling In Proceedings of ACL Yoav Goldberg and Michael Elhadad 2010 An efficient algorithm for easy-first...

Ngày tải lên: 07/03/2014, 18:20

... user a multi-document summary typical evaluation of a multi-document summarization system, gold standard summaries are created by hand and then compared against fixed length generated summaries ... domain of scientific article summarization, we used a widely used and freely available multi-document summarization system called MEAD (Radev, 2004) as our baseline MEAD uses centroid based summarization ... extraction, utility based evaluation, and user studies In NAACL-ANLP 2000 Workshop on Automatic summarization, pages 21-30, Morristown, NJ, USA [12, 16, 17] Radev, Dragomir 2004 MEAD - a platform...

Ngày tải lên: 17/03/2014, 00:20

... Byrne 2005 A weighted finite state transducer translation template model for statistical machine translation Natural Language Engineering To appear 270 Ying Zhang, Stephan Vogel, and Alex Waibel 2004 ... Southern California Kenji Yamada and Kevin Knight 2001 A syntax-based statistical translation model In Proceedings of the 39th Annual Meeting of the ACL, pages 523–530 Philipp Koehn 200 4a Pharaoh: a ... translation We compared a baseline system, the state-of-the-art phrase-based system Pharaoh (Koehn et al., 2003; Koehn, 200 4a) , against our system For all three systems we trained the translation...

Ngày tải lên: 17/03/2014, 05:20

... demonstrate in Section 4, very scalable NIAGARACQ COMMAND LANGUAGE NiagaraCQ defines a simple command language for creating and dropping continuous queries The command to create a continuous query has ... contains a brief discussion of the caching mechanisms in NiagaraCQ to make the system more scalable NiagaraCQ is the continuous query sub -system of the Niagara project, which is a net data management ... 4.1 System Architecture Figure 4.1 shows the architecture of Niagara system NiagaraCQ is a sub -system of Niagara that handles continuous queries NiagaraCQ consists of A continuous query manager,...

Ngày tải lên: 23/03/2014, 03:20

... 160–167, Sapporo, Japan Slav Petrov, Adam Pauls, and Dan Klein 2007 Discriminative log-linear grammars with latent variables In Advances in Neural Information Processing Systems 20 (NIPS), Vancouver, ... the NAACL (HLT-NAACL 2003), pages 134–141, Edmonton, Canada Christoph Tillmann and Tong Zhang 2007 A block bigram prediction model for statistical machine translation ACM Transactions Speech Language ... Natural Language Processing (EMNLP-2007), pages 737–745, Prague, Czech Republic Taro Watanabe, Jun Suzuki, Hajime Tsukada, and Hideki Isozaki 2007 Online large-margin training for statistical...

Ngày tải lên: 23/03/2014, 17:20

Ngày tải lên: 28/03/2014, 15:20

... personal health information system and the medical guidance 1) Personal health information system: The personal health system can store physiological data and other information in the database ... 2) Data processing: Data processing module is to process data depending on different categories of data which are get from data receiving module and take related action For physiological data, ... system can act as the personal health information system on the server The smart phone gets physiological data from sensors, and locally stores physiological data and other information such as...

Ngày tải lên: 28/03/2014, 19:21

... in common phrase-based translation systems: for them it has been shown that good translation performance can be achieved A systematic analysis of the novel training algorithm will allow us to ... Đ update  update (*) k select relevant points  for each data point ắ k for each decoding iteration :  and alternative initialize truth p for each data point mal statement here A detailed ... performance of phrasebased translation systems (Chiang, 2005; Och, 2003), this paper presents a novel block sequence translation approach to SMT that is similar to sequential natural language annotation...

Ngày tải lên: 31/03/2014, 01:20

... Sugiyama A, Kume H, Ota S, Kashima T, Tomita K, Kitamura T, Kodama T, Fukayama M, Aburatani H: Identification of Toll-like receptor as a potential therapeutic target in clear cell renal cell carcinoma ... dissolve the MTT-formazan crystals The absorbance was measured at 490 nm by an ELISA microplate reader (Bio-Rad) Besides that, the toxicity on Ana-1 and HUVEC cells were evaluated with the same method ... physic-chemical properties (size and charge) of each separate material, including PCFC-g-PEI and FA-PEAs, as well as the FA-PEAs: pVHL complexes Because PCFC-g-PEI and FA-PEAs are amphiphilic...

Ngày tải lên: 18/06/2014, 19:20

... Sugiyama A, Kume H, Ota S, Kashima T, Tomita K, Kitamura T, Kodama T, Fukayama M, Aburatani H: Identification of Toll-like receptor as a potential therapeutic target in clear cell renal cell carcinoma ... dissolve the MTT-formazan crystals The absorbance was measured at 490 nm by an ELISA microplate reader (Bio-Rad) Besides that, the toxicity on Ana-1 and HUVEC cells were evaluated with the same method ... physic-chemical properties (size and charge) of each separate material, including PCFC-g-PEI and FA-PEAs, as well as the FA-PEAs: pVHL complexes Because PCFC-g-PEI and FA-PEAs are amphiphilic...

Ngày tải lên: 20/06/2014, 03:20

... the case of a hand-held instrument, allows for a “snapshot” of the data stream to be made manually at a time chosen by the operator Use of this additional facility does not interrupt the data stream ... digital format has occurred Achieving reliable analogue amplification and filtering at the ultra low sensor outputs encountered proved to be unproductive in that every analogue stage produced and added ... and furnishes a compact and low cost method for the capture and integrated digital processing of measurement data in a range of situations including clinical diagnostic and treatment venues The...

Ngày tải lên: 22/06/2014, 01:20

... Cohen and A G Andreou, “Analog CMOS integration and experimentation with an autoadaptive independent component analyzer,” IEEE Transactions on Circuits and Systems II: Analog and Digital Signal Processing, ... Data ram Clock (a) Read in process w1 in Output process Decorrelation process w1 out Data ram 16 DEC Data ram NORM Data ram 16 CMP Counter Counter MUL w2 in ADD Counter Data ram Data ram 16 Clock ... of nongaussianity since Gaussian variable has the largest entropy among all random variables of equal variance [16] Because it is difficult to calculate negentropy, an approximation is usually given...

Ngày tải lên: 22/06/2014, 22:20