a coccidian parasite like any other
Tài liệu A DINING EXPERIENCE LIKE NO OTHER! PLANET HOLLYWOOD ppt
... BACARDI MALIBU CAPTAIN MORGAN MORGANS SPICED MOUNT GAY SAGATIBA CACHACA WOODS 100 RUM ATLANTICO BACARDI 151 TEQUILA SAUZA TEQUILA BLANCO TEQUILA SIETE LEGUAS BLANCO TEQUILA SIETE LEGUAS REPOSADO ... great combination after a meal CAIPIRINHA Sagatiba cachaca, lime quarters and sugar Brazil’s national drink! COSMOPOLITAN A sophisticated mix of cranberry, cointreau and absolut citron vodka ‘sex ... orange and cranberry PRINCESS DIARIES Strawberry, banana and a splash of grenadine COOL PLANET - SPIDERMAN Strawberry, banana and vanilla ice cream with a swirl of chocolate and whipped cream...
- 28
- 466
- 0
Tài liệu A dining experience like no other: PLANET HOLLYWOOD docx
... Glass Alabama Slammer Southern Comfort, Amaretto, sloe gin and orange juice Banana Pudding DeKuyper Banana, Baileys and Kahlua Blue Hawaii Malibu rum and blue curacao bubble gum Vodka and banana ... grenadine Spiderman Strawberry, banana, vanilla ice cream and a swirl of chocolate Far an d Away Monin Frosted Mint, Vanilla syrup and Dark Chocolate Sauce with Oreo® cookie and ice cream ® hand-dipped ... romaine hearts tossed with traditional Caesar dressing and aged Parmesan cheese Grilled Salmon CAESAR Grilled salmon with crisp romaine hearts tossed with traditional Caesar dressing and aged Parmesan...
- 10
- 509
- 0
Would a Roshanda by Any Other name smell as sweet
... Girl Names Sarah Emily Jessica * See note, p 303 174 Lauren Ashley Amanda A Roshanda by Any Other Name Megan Samantha Hannah 10 Rachel 11 Nicole 12 Taylor 13 Elizabeth 14 Katherine 15 Madison ... than “Madison” might have seemed ten years ago? Most Popular Girls’ Names of 2015? Annika Ansley Ava Avery Aviva Clementine Eleanora Ella Emma Fiona Flannery Grace Isabel Kate Lara Linden Maeve ... 17 Alexandra 18 Brittany 19 Danielle 20 Rebecca Most Common Low-Income White Girl Names Ashley Jessica Amanda Samantha Brittany Sarah Kayla Amber Megan 10 Taylor 11 Emily 12 Nicole 13 Elizabeth...
- 26
- 589
- 0
Put a,an,the,some,any
... in…………garden 37 This morning I had……….boiled egg and toast for breakfast 38 ………president of the United States is elected every four years 39 As I was walking along the street,I saw……E10 note on…….pavement ... hungry.I had……….big breakfast 52 Jonh was ……….only person I talked to at the party 53 Tim lives in…… small village in ………country 54 Peru is……… country in South America ………capital is Lima 55.I never ... restaurant in town 44 Do you want to watch……….television this evening? 45 Last night we went out for…… meal in……… restaurant 46 I wrote my name at……….top of the page 47 ……….moon goes round…… earth………each...
- 3
- 795
- 12
Tài liệu Báo cáo khoa học: Comparison of a coq7 deletion mutant with other respiration-defective mutants in fission yeast doc
... GATGCCTTCCAATGAATTAC GAACCAATGAAATAAGGGCG GGGGATCCGTCGACCTGCAGCGTACGAGGAAAGGAAATAGGC GTTTAAACGAGCTCGAATTCATCGATCCGTCAACGACAGTTG GCATCAGAAAGCATAGGC TGGGAATACGATAGAGTAG GTTTAAACGAGCTCGAATTC Gene ... CCGTCGACCAAGCTTATGTTTCCTTATTTTTACAGACG CCCCCGGGGCCACTTTCTGGTG GTACAAGCTTGTAAATTTTCGATGG CATAGAATTCTTGGTAATC AAAGTCGACATGTTGTCACGTAGACAG CAAGCAGGTGAATTAGGC GGGGATCCGTCGACCTGCAGCGTACGAAAATCGTTTACACATC GTTTAAACGAGCTCGAATTCATCGATGCTAGTCCTTTATG ... GTTTAAACGAGCTCGAATTCATCGATGCTAGTCCTTTATG CAGGCAAGTCTGTTTATTG CTTGGATGAGCTTTCCAC CGTATAAATTACAATACCG GGGGATCCGTCGACCTGCAGCGTACGACATACTACTTCATTTG GTTTAAACGAGCTCGAATTCATCGATCCTAGCGTTACCGTTG GTATGCGATGTGGAATTTG GATGCCTTCCAATGAATTAC...
- 16
- 646
- 0
Tài liệu Báo cáo khoa học: ˚ The 1.8 A crystal structure of a proteinase K-like enzyme from a psychrotroph Serratia species docx
... atoms of Asp11 and Asn23 (Fig 3) in an arrangement similar to what is observed in VPRK Both PRK and VPRK have calcium bound at Ca3 SPRK also has an aspartic acid residue at position at 200, and ... initial comparative studies showed that the catalytic turnover was at least twice that of PRK, but substrate affinity was reduced SPRK was compared with PRK and was found to be remarkable stable against ... hexa62 Table Data collection and refinement statistics for SPRK ˚ Resolution (A) Space group Cell parameters ˚ a- axis (A) ˚ b-axis (A) ˚ c-axis (A) b angle (°) Number of observations (24 – maximum...
- 11
- 551
- 0
Tài liệu Báo cáo khoa học: KIPase activity is a novel caspase-like activity associated with cell proliferation doc
... for caspases and 7; Ac-YVAD-AMC is a substrate for caspase 1; Ac-IETD-AMC is a substrate for caspase and 10; Ac-LEHD-AMC is a substrate for caspases 2, 4, and Ac-DVPD-AMC, Ac-DPSD-AMC and Ac-ESQD-AMC ... substrate (bar A) for each was as follows: caspase 1, WEHD-AMC; caspase 2, VDVADAMC; caspase 3, DEVD-AMC; caspase 4, WEHD-AMC; caspase 5, WEHD-AMC, caspase 6, VEID-AMC; caspase 7, DEVD-AMC; caspase ... cleavage of the apoptotic caspase substrates DEVD-AMC, DVPDAMC, IETD-AMC and LEHD-AMC were greatly stimulated over basal activity, peaking between and h poststimulation In contrast, cleavage...
- 8
- 442
- 0
Tài liệu Báo cáo Y học: Characterization of a cloned subtilisin-like serine proteinase from a psychrotrophic Vibrio species doc
... Invitrogen was used for expression The gene was amplified with PCR from genomic Vibrio DNA using the primers 5¢-ATGTTAAA GAAAGTATTAAGTTGTTG-TATTGCAGC-3¢ and 5¢-AAAGTTTGCTTGGAGCGTCAAGCC-ACTGTAAG CCG-3¢, ... each temperature), containing 100 mM NaCl, mM EDTA and 15 mM CaCl2, were heated and aliquots were withdrawn at intervals and immediately assayed for remaining activity against SucAAPF-NH-Np as ... proteinase gene primers were designed from the sequence of Vibrio alginolyticus [42]: 5¢-GCGGAATTCTACACCCGCTACATGTGGCGTCG CCAT-3¢ and 5¢-CGCGGATCCTGGGGACTAGATC GAATC-GACCAACGTAA-3¢ Underlined are...
- 11
- 550
- 0
Báo cáo khoa học: A novel metallocarboxypeptidase-like enzyme from the marine annelid Sabellastarte magnifica – a step into the invertebrate world of proteases pdf
... gamus, Molgula occidentalis and Pyura vittata); 11 species of Cnidaria (Bartholomea annulata, Budonosoma granulifera, Cassiopea xamachana, Condylactys gigantea, Gorgonia ventalina, Lebrunia danae, ... Mollusca, Echinodermata, Arthropoda and Chordata, amongst others, collected on the coasts of Havana, Cuba The 4876 Fig S magnifica Phylum Annelida, Class Polychaeta, Subclass Palpata, Order Canalipalpata, ... danae, Palythoa caribaeorum, Physalia physalis, Plexaura homomalla, Stichodactyla helianthus and Zoanthus pulchellus); two species of Annelida (Sabellastarte magnifica and Hermodice carunculata);...
- 16
- 628
- 0
Báo cáo Y học: Crystal structure of the catalytic domain of a human thioredoxin-like protein pdf
... Murakawa, M., Takahashi, S., Tsubuki, S., Kawashima, S., Sakamaki, K & Yonehara, S (1998) Purification, molecular cloning, and characterization of TRP32, a novel thioredoxin-related mammalian protein ... 136, 630–637 16 Nakamura, H., Matsuda, M., Furuke, K., Kitaoka, Y., Iwata, S., Toda, K., Inamoto, T., Yamaoka, Y., Ozawa, K & Yodoi, J (1994) Adult T cell leukemia-derived factor/human thioredoxin ... Jin, J., Gao, Y., Guo, Q., Sun, Y., Tang, H., Yuan, J., Qiang, B & Rao, Z (2001) Crystallization and preliminary X-ray analysis of a Trx domain of human thioredoxin -like protein Acta Crystallogr...
- 9
- 533
- 0
Báo cáo khoa học: Heterologous expression of a serine carboxypeptidase-like acyltransferase and characterization of the kinetic mechanism potx
... existence of a short-lived acyl-enzyme and a direct attack of the activated acyl acceptor l-malate Experimental procedures Plant material and yeast cells Tobacco plants (Nicotiana tabacum L cv Samsun) ... AM & Chapple C (2003) Biochemical characterization of sinapoylglucose:choline sinapoyltransferase, a serine carboxypeptidase -like protein that functions as an acyltransferase in plant secondary ... understanding the adaptation of hydrolases to catalyze acyltransfer reactions The kinetic characterization of AtSMT reaction revealed a random sequential bi-bi mechanism The presence of both sinapoylglucose...
- 13
- 310
- 0
Báo cáo khóa học: Trypanosoma brucei oleate desaturase may use a cytochrome b5-like domain in another desaturase as an electron donor docx
... (respectively: 5¢-CATGTCAC GGCTAAGGTAGC-3¢ and 5¢-CTAAGCAACAGATGG GAGGT-3¢) and GSS 38K3 (5¢-CCAACGCACCGTTCT TTCG-3¢ and 5¢-ACTGCGAGTAATGCAGATCC-3¢) identified in the T brucei genome database of TIGR ... degree and type of fatty acid desaturation between trypanosomes and their mammalian host, indicate that fatty acid desaturases may be good targets for trypanocidal drugs Fatty acid desaturases are ... containing an ORF with desaturase similarity A 1227 bp genomic clone was obtained by PCR amplification with the forward primer 5¢-CGGGATCCATGTTGCCTAAGCAACAGATG-3¢ and the reverse primer 5¢-CCCAAGCTTAACTGCGAG...
- 8
- 277
- 0
Báo cáo khoa học: Identification of the N-terminal region of TjZNT2, a Zrt⁄Irt-like protein family metal transporter, as a novel functional region involved in metal ion selectivity ppt
... -MASSPTKILCDAGESDLCRDDAAAFLLKFVAIASIL 1:MFFIDVLWKLFPLYLFGSERDYLSETESILKIVPETMAAASSLSILCDAGEPDLCRDDSAAFLLKLVAIASIF TjZNT1 TjZNT2 37:LAGVAGVAIPLIGKNRRFLQTEGNLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPDYPWSKFPFPGFFA ... Thlaspi caerulescens as a model system Ann Bot 102, 3–13 Weber M, Harada E, Vess C, Roepenack-Lahaye E & Clemens S (2004) Comparative microarray analysis of Arabidopsis thaliana and Arabidopsis halleri ... transport FEBS Lett 581, 2263–2272 N-terminus of TjZNT2 is involved in ion selectivity Tomatsu H, Takano J, Takahashi H, Watanabe-Takahashi A, Shibagaki N & Fujiwara T (2007) An Arabidopsis thaliana...
- 8
- 343
- 0
Báo cáo khoa học: Inhibitor-mediated stabilization of the conformational structure of a histone deacetylase-like amidohydrolase pptx
... compounds are called chemical chaperones and those compounds which act selectively on a certain pharmaceutical target protein are called pharmacological chaperones Although the precise mechanism of action ... reported by Ray et al [31] and Chakrabarti et al [32], although the observed changes in the biophysical parameters were much smaller as compared with the denaturation of HDAH Saturating concentrations ... stabilization of HDAH 31 Ray S, Bhattacharyya M & Chakrabarti A (2005) Conformational study of spectrin in presence of submolar concentrations of denaturants J Fluoresc 15, 61–70 32 Chakrabarti...
- 11
- 393
- 0
Báo cáo khoa học: Selection of peptides inhibiting a b-lactamase-like activity docx
... 348 and AB 349 primers annealing at 54 °C for and elongation at 72 °C for 1.5 Taq DNA polymerase was purchased from New England Biolabs The forward primer AB 348, 5¢-TTAGCAAAACCTC ATACAGAA-3¢, and ... showed a significant capability to bind the Ig The library gave a weaker ELISA signal than isolated clones that have encountered five rounds of selection because it contains many phage that are not ... resonance Phage ELISA appeared to be an efficient qualitative assay However, it cannot be used to measure accurate Kd values because the affinity of the Ig for phage particles probably takes part of...
- 7
- 428
- 0
Báo cáo hóa học: "Research Article A Random Ant-Like Unicast Routing Protocol for Wireless Ad Hoc Sensor Networks and Performance Evaluation" pdf
... treated like any data packet that cannot be forwarded at a node due to an invalid path in its header The node carries out a route discovery operation, as described earlier, to find an alternative path ... provide performance comparison with other routing algorithms We also conduct an approximated mathematical analysis for the RAUR to analyze its performance RAUR is a source routing-based algorithm ... traffic load, it is scalable as the routing load change is small and gradual even at higher number of sending sources The advantages of RAUR are due to its unicast routing mechanism We have also...
- 7
- 441
- 0
Act like a lady - Think like a man (By Steve Harvey) ppt
... secure and upbeat; if he can afford meat at the grocery store, then he can feel assured that he can feed his family This is all any man wants; anything less, and he doesn’t feel like a man Even ... opposing teams a practice that gave them a distinct advantage over their rivals For sure, the Patriots’ dirty ways were almost as advantageous to the New England team as if they were reading the ... playbook With the advantage, the Patriots were able to win games This is what I wish for the women who read Act Like a Lady, Think Like a Man I want every woman who truly wants a solid relationship...
- 242
- 621
- 4
Báo cáo y học: "The potential of human regulatory T cells generated ex vivo as a treatment for lupus and other chronic inflammatory diseases" pot
... 39 Yamamoto H, Hirayama M, Genyea C, Kaplan J: TGF-beta mediates natural suppressor activity of IL-2-activated lymphocytes J Immunol 1994, 152:3842-3847 40 Gray JD, Hirokawa M, Horwitz DA: The ... self-tolerance; deficit of a T cell subset as a possible cause of autoimmune disease J Exp Med 1985, 161:72-87 Kuniyasu Y, Takahashi T, Itoh M, Shimizu J, Toda G, Sakaguchi S: Naturally anergic and ... allogeneic organ transplants Acknowledgements This research was supported in part by National Institutes of Health grant AI 41768, The Nora Eccles Treadwell Foundation, and the Arthritis Foundation-Southern...
- 6
- 408
- 0
Báo cáo y học: "Cia5d regulates a new fibroblast-like synoviocyte invasion-associated gene expression signature" pptx
... CCCCAAGACCCAGTGGAA TCCTCCa CTCTTCCCACCTTATCTGAGGA GACCTGAAGGGGCAGATG AGGTACCGGGCGATGTTCT GGCCTGTTTGGCACTATGTGA LOC309362 Dnmbp 16 Exiqon Universal probe 97 TTGTCTCAGCATGGGTCCTA ACCAGGATTTTAAGGCCACA NM_001107408 ... TTCGGACCAGCTCTTAGAGAA GCCTGGTCCTGAGACAAAAG XM_220552.3 Trim16 Exiqon Universal probe GTGAACTCCTTCCCACTCCA CAGCTGCATTTCTGGAAACA NM_017207.1 Trpv2 15 Exiqon Universal probe NM_019357.1 Vil2 13 CCCCAAGACCCAGTGGAA ... 3–4 Exiqon Universal probe 17 GTCGTGGACCTCCACAAAAT GAACCGTCCAATAAAAGTCTGC Down-regulated in DA XM_235434.4 Gsdmdc1 13 Exiqon Universal probe 68 AGCACGTCTTGGAACAGAGC TCCTCATCCCAGCTGTCC XM_222868.4...
- 14
- 337
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct hệ số công suất cosp fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25