... was amplified by PCR using the following primers: forward, 5¢-CATGCC ATGGCGCCATTTTTCTTGAGACATGCC-3¢; reverse, 5¢-CTGGGATCCGTCCGAATCAGGTTCCTTC-3¢ (purchased from Sigma), and the pKK plasmid as a ... crystal structure of PcrA helicase [16], additional interdomain (domain closure), and intradomain and side-chain conformational changes, occur upon binding of ATP and nucleic acid to ensure ATPase ... corresponding to the released strand and to the nonunwound substrate were cut out and 32 P radioactivity counted Alternatively, the films were scanned and the radioactivity associated with the released...
Ngày tải lên: 08/03/2014, 02:20
... jelly-roll domain and a C- terminal b-trefoil domain The rmsd values were ˚ ˚ 2.5 A for HCR ⁄ D- SA and HCR ⁄ D and 0.5 A for HCR ⁄ D- SA and HCR ⁄ C The greater rmsd values for HCR ⁄ D- SA and HCR ⁄ D were ... solvent, and HCR ⁄ B has a loop that is more structurally analogous to those of HCR ⁄ C and HCR ⁄ D, but lacking a Trp Fig GBLs of HCR ⁄ C, HCR ⁄ D and HCR ⁄ D- SA overlaid with HCR ⁄ A and HCR ⁄ B HCR ... domains in direct contact with each other [8] Retention of function by the three individual domains (LC, HCT, and HCR) has facilitated the structure–function characterization of BoNT and tetanus...
Ngày tải lên: 22/03/2014, 15:21
Xem lọat tranh A.C.I.D của Bùi Anh Phong: Vài ghi chú về một sự khởi đầu… pdf
... người -d ờng c thương c m đ c biệt đó -c n lại, hình hiệu đơn giản, tồn đan xen vào nhau, chia c t lẫn Sự biến đổi c u tạo hình diện kh c biệt hình th c đan xen, chia c t, thể tương phản nhiều c p ... kết c u bề mặt vật liệu, đến bố c c, màu s c -đã tạo cho t c phẩm Phong c c u tr c tạo ngh a s c thái biểu c m a d ng Phong tỏ th c vi c sử d ng ngôn ngữ tự trị hình màu (không phụ thu c giới ... Phong ch a đầy hai tháng Nhưng qua vài lần trò chuyện, xem qua lọat tranh Phong, c m thấy đ c biệt yêu thích Tôi yêu thích hành động d m từ bỏ mà chung thủy với hội h a thời gian d i làm quảng c o...
Ngày tải lên: 29/06/2014, 06:20
A.C.I.D. by Bui Anh Phong pot
... a certain peaceful and poetical image, but what appears on the canvas only suggests feelings of somber, anxiety This contra-effect is not a failure It makes such feelings become a deep impact ... world — experiments imbued with poetical and philosophical nuances “Entering” The main objects in Phong’s new painting series are human faces, crossroads and traffic signs, so to speak, but of all ... the human face is like a sphere inflated with zealousness, frustration and solitude The red line across it looks so strange, appearing as a challenge — transforming the deep blue space behind it...
Ngày tải lên: 29/06/2014, 06:20
Báo cáo toán học: "Two remarks concerning the theorem of S. Axler, S.-Y. A. Chang and D. Sarason " docx
Ngày tải lên: 05/08/2014, 15:20
Báo cáo toán học: " Geometrically constructed bases for homology of partition lattices of types A, B and D" ppt
... coefficient +1 at c and coefficient at all c ∈ F (P
Ngày tải lên: 07/08/2014, 08:22
Đề thi chọn học sinh giỏi tỉnh Long An môn tiếng Anh lớp 12 - Vòng 1, bảng A (có đáp án)
... that people enjoy crying together almost as much as laughing together A world B place C earth D space A communicate B persuade C inform D demonstrate A evolve B change C develop D alter A doing ... that each building appears to have had at least one standing stone inside it, and that one house actually had three The plaster-covered human shaped obelisk (9) shoulders and the stumps ... shown that the house had (4) with clay-coated, lime-plastered walls and floor So far excavation have unearthed three buildings containing seven standing stones, (5) retain traces of...
Ngày tải lên: 23/11/2015, 07:07
Đề thi chọn học sinh giỏi tỉnh Long An môn Sinh học lớp 12 - Vòng 1, bảng A (có đáp án)
... đường rau, muốn làm d a chua phải c hàm lượng đường rau, 5-6% rau c i c hàm lượng đường thấp 5% Sử d ng nư c d a chua c nhằm cung c p vi khuẩn lactic - D a để lâu hàm lượng axit lactic tăng d n ... Biết c p alen Aa d i 510 nanomet, alen A c 3600 liên kết hidro, alen a c tổng tỉ lệ Adenin loại nucleotit kh c chiếm 40% C p alen Bb alen d i 306 nanomet, alen B c Timin 20%, alen b c tỉ ... lai phân tích 1: 1: 1: KG thể BbDd (2 locut B (b) D (d) nằm NST tương đồng kh c nhau) Sơ đồ lai BbDd x bbdd ⇒ 1BbDd: Bbdd: bbDd: bbdd Nếu kết kiểu hình lai phân tích 1:1 KG thể BD bd (2 locut...
Ngày tải lên: 23/11/2015, 07:07
Tài liệu Tài liệu đào tạo môi trường (Các khoá A, B, C và D) doc
... Danh m c tài liệu Khoá h c A: Phát triển bền vững Nhận th c Môi trờng Bài - C c đ c điểm đ a lý, d n c sinh thái lu v c sông Mê C ng Bài - Những hoạt động th c tiễn không bền vững lu v c sông ... để phát triển QLTN&MTT c Hiệu Bài - Chính sách c ng c Bảo vệ Môi trờng Bài - C c công c quản lý tài nguyên n c tổng hợp (IREM) th c tế Khoá h c D: Thủ t c Đánh giá T c động Môi trờng Quyết ... sông Mê C ng Khoá h c B: Giới thiệu Khoa h c Môi trờng lu v c sông Mê C ng Bài - Định ngh a môi trờng lu v c sông Mê C ng Bài - Giới thiệu khái niệm khoa h c hệ sinh thái Bài - C n n c vùng đất...
Ngày tải lên: 09/12/2013, 21:15
iec 60298 a.c. metal-enclosed switchgear and controlgear for rated voltages above 1 kv and up to
... contained in metal-enclosed switchgear and controlgear are to be designed and tested in accordance with their various relevant standards This standard supplements the standards for the individual ... metal-enclosed switchgear and controlgear is subdivided into three types: - metal-clad switchgear and controlgear; - compartmented switchgear and controlgear (with - cubicle switchgear and controlgear ... switchgear and controlgear (with non-metallic partitions) Metal-enclosed switchgear and controlgear in which components are arranged in separate compartments as for metal-clad switchgear and controlgear,...
Ngày tải lên: 25/12/2013, 10:57
Tài liệu r e f e r e n c e p r a c t i c e a d v a n c e d o f b o o k a n d f o r l e a r n e r s E n g l pdf
Ngày tải lên: 19/01/2014, 07:20
Tài liệu Debugging C and C++ code in a Unix environment ppt
... bud by doing static analysis early; see the section called Using the compiler’s features Explicit storage allocation and deallocation In C and C+ +, you have to explicitly allocate and deallocate ... the causes of problems with C and C+ + code, is the policy of requiring explicit allocation and deallocation of dynamic storage (malloc(2) and free(2) (C) or new and delete (C+ +)) As C and C+ + ... it Chapter Aspects of debugging C and C+ + code Debugging C and C+ + code entails noticing, localising, understanding and repairing bugs Noticing and localising a bug You might think that noticing...
Ngày tải lên: 21/01/2014, 06:20
Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc
... intermediates 6b and 6d; and PALA for intermediate 4c Western blot analysis with an antibody against ETA showed that cathepsins B and D degraded ETA in a pH-dependent manner, with maximal degradation ... GWEQLEQCGYPVQRLVALYLAARLSWNQVDQV IRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVVSLTCP VAAGECAGPADSGDALLERNYPTGAEFLGDGGDVSFSTRGTQNWTVERLLQAHRQLEERGYV FVGYHGTFLEAAQSIVFGGVRARSQDLDAIWRGFYIAGDPALAYGYAQDQEPDARGRIRNGA ... produce fragments with a molecular mass very close to that of intact ETA All cleavages produced by cathepsins B and D in the ETA toxin are located within ETA -A A major degradation product of ETA...
Ngày tải lên: 18/02/2014, 04:20
Tài liệu Báo cáo khoa học: Insights into the structure of plant a-type phospholipase D Susanne Stumpe, Stephan Konig and Renate Ulbrich-Hofmann ¨ ppt
... I(0), a molecular mass of 97 kDa was calculated (using BSA as standard), which is in accordance with a monomer of PLDa2 Correspondingly, no aggregates were detected at a PLDa2 concentration of ... Influence of the calcium concentration on PLDa2 activity (A) Relative activity as function of calcium chloride (black) and calcium acetate (gray) concentration, respectively (B) Double hyperbolic ... at 280 nm Aldolase (150 kDa), ovalbumin (45 kDa), chymotrypsinogen A (25 kDa), and cytochrome c (12.3 kDa) (Serva, Heidelberg, Germany) were used as molecular mass standards Absorption and CD...
Ngày tải lên: 19/02/2014, 02:20
Tài liệu Báo cáo khoa học: Structural and functional specificities of PDGF-C and PDGF-D, the novel members of the platelet-derived growth factors family docx
... linked to prostate cancer progression by the cellular colocalization of PDGF -D and its activator uPA in prostate carcinoma cells [44] PDGF -D is upregulated in human lung and ovarian cancers compared ... but contain dibasic cleavage sites for proteolytic removal of the CUB domains and thereby activation of the growth factor domains PDGF -C and -D contain both the CUB and growth factor domains ... published 3D model of the PDGF -C growth factor domain indicates the disulfide bridges in PDGF -C to consist of Cys250 and 294, Cys280 and 335, and Cys287 and 337, and the intermonomeric bonds to consist...
Ngày tải lên: 19/02/2014, 07:20
Báo cáo khoa học: A new approach for distinguishing cathepsin E and D activity in antigen-processing organelles pdf
... and ovarian cancer [20] CatE is expressed in pancreatic ductal adenocarcinoma [21], and its presence in pancreatic juice is reported to be a diagnostic marker for this cancer [22] Increased concentrations ... not detectable Cell line Activity Cytosolic fraction Lysosomal fraction Endosomal fraction HaCaT TAPA Cat E Cat D TAPA Cat E Cat D TAPA Cat E Cat D 13.4 13.4 ND 0.49 0.49 ND 0.76 0.76 ND 106.3 ... Parallel detection of CatE and CatD activity TAPA and speci c catalytic activities of CatE and CatD were determined fluorimetrically by hydrolysis of the substrate MOCAc-Gly-Lys-Pro-Ile-Leu-Phe-Phe-Arg-LeuLys(Dnp) -d- Arg-NH2...
Ngày tải lên: 07/03/2014, 09:20
Báo cáo khóa học: Characterization of Mesorhizobium huakuii lipid A containing both D-galacturonic acid and phosphate residues ppt
... be the same in all Gramnegative bacteria and lead to a 1,4¢-bisphosphorylated aminosugar disaccharide acylated at positions 2, 3, 2¢, 3¢ by 3-hydroxyl fatty acids Kdo disaccharide occupies position ... protons and protons from a, b and c positions of 3-hydroxy fatty acids are marked with; -CH ¼ CH-, -CH3, and -CH2-, a, b and c, respectively CHCl3, DMSO and H2O represent signals from solvents and absorbed ... lipid A species Crude lipid A was purified and separated into subfractions according to a modified procedure described by Que and coworkers [9] Briefly, lyophilized lipid A ( 30 mg) was dissolved...
Ngày tải lên: 07/03/2014, 15:20