776 analysis of the d latch for a few transitions

An analysis of the Singaporean preparation for the future workforce and recommendations for Vietnam

An analysis of the Singaporean preparation for the future workforce and recommendations for Vietnam

... employees had a clear view of the skills required for digital transformation; 16% indicated that they had no idea at all on the skills and capabilities required; and the large majority of 70% fell ... upgrading and mastery Individuals in their early and/or midcareer can use the Skills Framework to make informed decisions on education and training, career development and skills upgrading based ... study awards annually at a later stage (x) Education and Career Guidance (ECG): ECG is a holistic and experiential effort for Singaporeans from different stages of life e.g students, adults, individuals

Ngày tải lên: 16/01/2020, 12:21

22 41 0
Analysis of the Strategic Initiatives for the Block at Tusculum College

Analysis of the Strategic Initiatives for the Block at Tusculum College

... the traditional semester), if any, have you heard of or read about? Please describe b What academic calendar would you recommend for Tusculum and why? Please describe that calendar Faculty Baseline ... she had worked in the Registrar’s Office before the Block began and suggested the office became busier with the 18-classday schedule compared to a traditional semester calendar Another faculty ... 2012 came to college with an average ACT of 26, lower than Colorado’s students, and average GPA of 3.44 Students pay $35,000 per academic year in tuition, and including room and board as well as

Ngày tải lên: 19/10/2022, 01:17

65 3 0
elucidating pharmacological mechanisms of natural medicines by biclustering analysis of the gene expression profile a case study on curcumin and si wu tang

elucidating pharmacological mechanisms of natural medicines by biclustering analysis of the gene expression profile a case study on curcumin and si wu tang

... isolated natural medicine [11,12]) and Si-Wu-Tang (a classic traditional Chinese medicine formula, consisting of Radix Angelicae sinensis, Radix Rehmanniae Preparata, Radix Paeoniae Alba and Rhizoma ... elucidate the therapeutic mechanisms of natural medicines, in which DNA microarray is of special interest [2] DNA microarray offers a relatively cheap and easily handle facility to systematically ... p-values adjusted by False Discovery Rate calculation using Benjamini-Hochberg method [24] KEGG Term Amino sugar and nucleotide sugar metabolism Arachidonic acid metabolism Ascorbate and aldarate

Ngày tải lên: 02/11/2022, 09:23

12 5 0
Báo cáo hóa học: "  Research Article An Extension of the Invariance Principle for a Class of Differential Equations with Finite Delay"

Báo cáo hóa học: " Research Article An Extension of the Invariance Principle for a Class of Differential Equations with Finite Delay"

... Hale, “Dynamical systems and stability,” Journal of Mathematical Analysis and Applications, vol 26, pp 39–59, 1969 7 J P LaSalle, The Stability of Dynamical Systems, SIAM, Philadelphia, Pa, ... a Class of Differential Equations with Finite Delay Marcos Rabelo1 and L F C Alberto2 Departamento de Matem´atica, Universidade Federal de Pernambuco, UFPE, Recife, PE, Brazil Departamento de ... Yoshizawa, Stability Theory by Liapunov’s Second Method, Publications of the Mathematical Society of Japan, no 9, The Mathematical Society of Japan, Tokyo, Japan, 1966 12 J P LaSalle, The Stability

Ngày tải lên: 10/11/2023, 18:15

14 6 0
Báo cáo toán học: " Decision making for cognitive radio equipment: analysis of the first 10 years of exploration" potx

Báo cáo toán học: " Decision making for cognitive radio equipment: analysis of the first 10 years of exploration" potx

... (level of uncertainty on the captured numerical value for instance) as well as the global information held by the CR. Finally, the made decisions are translated into appropriate bandwidth occupation ... today’s radio devices need a specific dedicated electronic chain for each standard, switching from one standard to another when needed (known as the Velcro approach [2]). With the growth of the number ... mitigate this paradox, time limited reasoning has been suggested by Mitola. As a matter of fact, radio systems need to observe, decide, and act within a limited amount of time: The timer and related

Ngày tải lên: 20/06/2014, 20:20

41 495 0
Báo cáo hóa học: " Correlation analysis of the speech multiscale product for the open quotient estimation" doc

Báo cáo hóa học: " Correlation analysis of the speech multiscale product for the open quotient estimation" doc

... signal, we proceed to a correlation analysis for the fundamental frequency and OQ measurement The approach validation is done on voiced parts of the Keele University database by calculating the absolute ... exceed 13% for female speakers and 21% for male speakers Besides, the proposed approach for the OQ estimation can be considered as interesting and efficient regarding the error values and the lack ... voiced segments extracted from the database are handled by our algorithm To evaluate the performance of our approach for OQ estimation, we calculate absolute and relative errors between OQ estimated

Ngày tải lên: 20/06/2014, 22:20

12 543 0
báo cáo hóa học:" Research Article Analysis of the Effects of Finite Precision in Neural Network-Based Sound Classifiers for Digital Hearing Aids" pot

báo cáo hóa học:" Research Article Analysis of the Effects of Finite Precision in Neural Network-Based Sound Classifiers for Digital Hearing Aids" pot

... paper focuses on exploring to what extent the use of a quantized, approximated neural network-(NN-) based classifier embedded in a digital hearing aid could appreciably a? ??ect the performance of ... Member) Departamento de Teor? ?a de la Se˜ al y Comunicaciones, Escuela Polit´cnica Superior, Universidad de Alcal´ , ı n e a 28805 Alcala de Henares, Spain Correspondence should be addressed to Roberto ... related to the fact that hearing aid users usually face a variety of sound environments A hearing aid capable of automatically classifying the acoustic environment that surrounds his/her user, and

Ngày tải lên: 21/06/2014, 20:20

12 414 0
Báo cáo hóa học: "Decision making for cognitive radio equipment: analysis of the first 10 years of exploration" potx

Báo cáo hóa học: "Decision making for cognitive radio equipment: analysis of the first 10 years of exploration" potx

... (level of uncertainty on the captured numerical value for instance) as well as the global information held by the CR. Finally, the made decisions are translated into appropriate bandwidth occupation ... today’s radio devices need a specific dedicated electronic chain for each standard, switching from one standard to another when needed (known as the Velcro approach [2]). With the growth of the number ... mitigate this paradox, time limited reasoning has been suggested by Mitola. As a matter of fact, radio systems need to observe, decide, and act within a limited amount of time: The timer and related

Ngày tải lên: 21/06/2014, 23:20

41 301 0
Báo cáo khoa học: " Characteristics and outcome for admissions to adult, general critical care units with acute severe asthma: a secondary analysis of the ICNARC Case Mix Programme Database" pps

Báo cáo khoa học: " Characteristics and outcome for admissions to adult, general critical care units with acute severe asthma: a secondary analysis of the ICNARC Case Mix Programme Database" pps

... We conducted a secondary analysis of data from a high-quality clinical database (the Intensive Care National Audit and Research Centre [ICNARC] Case Mix Programme Database) of 129,647 admissions ... from the dates and times of admission and discharge. Length of stay in hospital was calculated in days from the dates of original admission and ultimate discharge. Transfers in from another hospital ... that of COPD in admitted patients who are older than 45 years. In these analyses, the diagnosis of asthma was based on the recorded primary or secondary reason for admission to ICU. COPD remains

Ngày tải lên: 12/08/2014, 20:20

10 308 0
Báo cáo khoa học: "Case mix, outcome and activity for patients admitted to intensive care units requiring chronic renal dialysis: a secondary analysis of the ICNARC Case Mix Programme Database" pptx

Báo cáo khoa học: "Case mix, outcome and activity for patients admitted to intensive care units requiring chronic renal dialysis: a secondary analysis of the ICNARC Case Mix Programme Database" pptx

... a national comparative audit of adult, general critical care units in England, Wales and Northern Ireland coordinated by the Intensive Care National Audit & Research Centre (ICNARC). Data ... had a complete primary reason for admission speci- fied, 230 (6.7%) had a partially coded reason for admission, and the remaining one admission (0.03%) had no reason for admission recorded. Of ... remainder of the CMP Database, excluding admissions of patients for whom there was no evidence available to assess past medical history. The primary reason for admission to the CMP unit (coded

Ngày tải lên: 13/08/2014, 03:21

14 286 0
Báo cáo sinh học: "A Bayesian analysis of the effect of selection for growth rate on growth curves in rabbits" doc

Báo cáo sinh học: "A Bayesian analysis of the effect of selection for growth rate on growth curves in rabbits" doc

... was declared to be an outlier if the standardized absolute value of the residual posterior mean was larger than three standard deviations from the standard normal distribution [6]. An atypical ... rough data with a Gompertz curve, and examining the s .d. of the residuals, we concluded that the evolution of the standard deviation of the residuals could be represented following a Gompertz law; ... multiplicative instead of addit- ive, and, second, it is not possible to find the standard errors of the parameters in the original scale, and approximate standard errors should be used. Moreover,

Ngày tải lên: 14/08/2014, 13:21

21 301 0
Báo cáo khoa học: Molecular cloning of the Matrix Gla Protein gene from Xenopus laevis Functional analysis of the promoter identifies a calcium sensitive region required for basal activity doc

Báo cáo khoa học: Molecular cloning of the Matrix Gla Protein gene from Xenopus laevis Functional analysis of the promoter identifies a calcium sensitive region required for basal activity doc

... Splice acceptor Phase of intron acag|gtaag tatg|gtaag tatg|gtaag agag|gtaag g(t)5aacag|aagaa c(t)4gtatacag|actc a( t)4cag|atcc c(t)4ag|aatc Not in coding region I I II (2929) (986) (1985) (1490) Table ... (5Â-CGGGATCCCAATCTGTTGCTAA TTAGG-3Â) and the 3Â specic oligonucleotides (5Â-GA AGATCTACCACACCTCCTCATCTCC-3Â) for amplication of the region from )180 to )36 and (5Â-GAAGAT CTAACTAGATTTTACCATTGG-3Â) for amplication of ... is associated with a calcium sensitive regulatory mechanism The amplitude of the observed transactivation and the effective range of calcium concentrations are similar to the data presented for...

Ngày tải lên: 08/03/2014, 10:20

10 475 0
Báo cáo khoa học: Molecular analysis of the interaction between cardosin A and phospholipase Da Identification of RGD/KGE sequences as binding motifs for C2 domains pdf

Báo cáo khoa học: Molecular analysis of the interaction between cardosin A and phospholipase Da Identification of RGD/KGE sequences as binding motifs for C2 domains pdf

... DDNPIGATLIGR ELLDGDEVDKa YPGVPYTFFAQR VSLYQDAHVPDNFIPKa VALMVWDDR DPDDGGSILQDLK IVVVDHELPR YDSAFHPLFSTLDSAHHDDFHQPNYAGASIAKa EPWHDIHSR SIDGGAAFGFPDTPEEASKa SIQDAYINAIR SDDIDVDEVGALHLIPKa DIVDALQDKa ... recombinant cardosin A with native cardosin A (Fig 2B) A Molecular cloning of C cardunculus L PLDa cDNA and characterization of the deduced amino-acid sequence To characterize further cardoon PLDa, ... raised against cabbage PLDa that cross-reacted with our 90-kDa cardosin A- binding protein (Fig 1B) After the identification of cardoon PLDa as a cardosin Abinding protein, we examined whether cardosin...

Ngày tải lên: 30/03/2014, 11:20

13 455 0
Báo cáo y học: " Cost-effectiveness analysis of the available strategies for diagnosing malaria in outpatient clinics in Zambia" potx

Báo cáo y học: " Cost-effectiveness analysis of the available strategies for diagnosing malaria in outpatient clinics in Zambia" potx

... ACER values were recalculated maintaining the observed drug prescription practices Data entry and analysis Morbidity data was entered and analysed in STATA version Cost data was entered and analysed ... reduced the costs of case correctly diagnosed Strengths This study was conducted within the actual malaria context using field-based data in a malarious population The advantage of field-based ... falciparum 2002 malaria in Uganda Trans R Soc Trop Med Hyg 2002, 96:254-257 Mendiratta DK, Bhutada K, Narang R, Narang P: Evaluation of different methods for diagnosis of P falciparum malaria Indian...

Ngày tải lên: 13/08/2014, 11:22

12 394 0
Báo cáo hóa học: " The equiconvergence of the eigenfunction expansion for a singular version of onedimensional Schrodinger operator with explosive factor" pptx

Báo cáo hóa học: " The equiconvergence of the eigenfunction expansion for a singular version of onedimensional Schrodinger operator with explosive factor" pptx

... Alexandria University Author details Department of Mathematics, Faculty of Education, Alexandria University, Alexandria, Egypt 2Faculty of Industrial Education, Helwan University, Cairo, Egypt Authors’ ... contributions The two authors typed read and approved the final manuscript also they contributed to each part of this work equally Competing interests The authors declare that they have no competing ... equiconvergence of the eigenfunction expansion of a singular boundary value problem.Az,NEENTE, No.96AZ -D, 1983 Nimark, MA: The study of eigenfunction expansion of non-self adjoint differential operator of the...

Ngày tải lên: 20/06/2014, 22:20

11 260 0
Báo cáo hóa học: " The equiconvergence of the eigenfunction expansion for a singular version of onedimensional Schrodinger operator with explosive factor" potx

Báo cáo hóa học: " The equiconvergence of the eigenfunction expansion for a singular version of onedimensional Schrodinger operator with explosive factor" potx

... Alexandria University Author details Department of Mathematics, Faculty of Education, Alexandria University, Alexandria, Egypt 2Faculty of Industrial Education, Helwan University, Cairo, Egypt Authors’ ... contributions The two authors typed read and approved the final manuscript also they contributed to each part of this work equally Competing interests The authors declare that they have no competing ... equiconvergence of the eigenfunction expansion of a singular boundary value problem.Az,NEENTE, No.96AZ -D, 1983 Nimark, MA: The study of eigenfunction expansion of non-self adjoint differential operator of the...

Ngày tải lên: 20/06/2014, 22:20

11 268 0
Báo cáo toán học: "A new determinant expression of the zeta function for a hypergraph" ppt

Báo cáo toán học: "A new determinant expression of the zeta function for a hypergraph" ppt

... obtained by Hashimoto [5] Bass proved the second identity by using a linear algebraic method Stark and Terras [9] gave an elementary proof of this formula, and discussed three different zeta functions ... fundamental group of G was developed by Sunada [11,12] Hashimoto [4] treated multivariable zeta functions of bipartite graphs Bass [2] generalized Ihara’s result on the zeta function of a regular ... functions of graphs, and showed that the reciprocals of zeta functions of regular graphs are explicit polynomials A zeta function of a regular graph G associated with a unitary representation of the...

Ngày tải lên: 08/08/2014, 01:20

13 271 0
Tài liệu Báo cáo khoa học: Application of a fluorescent cobalamin analogue for analysis of the binding kinetics A study employing recombinant human transcobalamin and intrinsic factor pdf

Tài liệu Báo cáo khoa học: Application of a fluorescent cobalamin analogue for analysis of the binding kinetics A study employing recombinant human transcobalamin and intrinsic factor pdf

... originally obtained as Cbl-saturated holo-forms, and preparation of the unsaturated apo-forms required their denaturing Unfolding of TC with m guanidine hydrochloride (GdnHCl) was earlier found to ... the afnity for a ligand is decreased by a factor of 106 (e.g., to Kd 110 nm) Additional observation indicates that the reduced afnity for the analogue CBC had no effect on the recognition of ... 5A Already a rough comparison of the dissociation velocities indicated at least a 10-fold faster liberation of the uorescent analogue when compared with Cbl The CBC dissociation spanned at least...

Ngày tải lên: 19/02/2014, 05:20

12 603 0
Báo cáo khoa học: Purification and structural analysis of the novel glycoprotein allergen Cyn d 24, a pathogenesis-related protein PR-1, from Bermuda grass pollen pot

Báo cáo khoa học: Purification and structural analysis of the novel glycoprotein allergen Cyn d 24, a pathogenesis-related protein PR-1, from Bermuda grass pollen pot

... E GAG A GCC T ACC L TTG A GCC Y TAC E GAG D GAC H CAC D GAC Q CAG A GCA S AGC V GTC S TCC A GCT N AAC K AAG A GCG N AAC E GAG Y TAC D GAC K AAG L CTA K AAG Q CAG L CTC G GGC G GGG E GAG E GAG ... AGAD AADA.NA.VG D. D 113 Zea AYA.S A- QRQG LI GG FW AGAD.SASDA.GS.VS QY.DHDT.S 112 Nicotiana AYA.N S-Q.AA NL HGQ AE -GDFMTAAKA.EM.V QY.DHD 118 Cyn d 24 DQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIMCSYWPPGNYENQKPY ... the immobilized antigen After washes, alkaline phosphatase-conjugated mouse antihuman IgE antibody (1000-fold diluted) was added for h at 37 °C, the alkaline phosphatase activity was measured...

Ngày tải lên: 07/03/2014, 12:20

10 665 0
Equipment for older and disabled people: an analysis of the market potx

Equipment for older and disabled people: an analysis of the market potx

... building adaptations and additions, and spectacles and contact lenses also had to be excluded What we did This study involved a combination of desk research and interviews with a number of key ... Institute for Ageing and Health–Years Ahead Partnership that funding has been secured for a feasibility study aimed at establishing a recognised product accreditation and approval scheme for Independent ... satisfactorily for consumers to the regulators and the Office of Fair Trading We are interested in seeing further analysis of the issues by the OFT Equipment for older and disabled people: an analysis of the...

Ngày tải lên: 08/03/2014, 13:20

46 1,1K 0
w