3 interaction of nitrogen dioxide with aliphatic polyamides and polyurethanes

Investigation of the interaction of antimicrobial peptides with lipids and lipid membranes 3

Investigation of the interaction of antimicrobial peptides with lipids and lipid membranes 3

... 7 .3 Results and discussion 7 .3. 1 Isotherm studies of V4 interacting with POPG and POPC 7 .3. 1.1 Isotherms of lipid monolayers The surface pressure (π) and molecular area (A) isotherms for POPG and ... prepare a solution with V4 concentration of 0.2mM Required volume of POPG or POPC was mixed with V4 to form lipid/V4 mixture with V4 percentage of 0%, 5%, 10%, 20%, 33 %, 50% and 100% A syringe ... confirmed the role of electrostatic interaction in the penetration process 169 7 .3. 3 AFM studies of antimicrobial peptides interacting with lipid monolayers 7 .3. 3.1 AFM images of pure lipid monolayers...

Ngày tải lên: 14/09/2015, 23:32

69 330 0
Báo cáo Y học: Molecular interaction of neutral trehalase with other enzymes of trehalose metabolism in the fission yeast Schizosaccharomyces pombe pdf

Báo cáo Y học: Molecular interaction of neutral trehalase with other enzymes of trehalose metabolism in the fission yeast Schizosaccharomyces pombe pdf

... Composition and functional analysis of the Saccharomyces cerevisiae trehalose synthase complex J Biol Chem 2 73, 33 311 33 319 Kopp, M., Muller, H & Holzer, H (19 93) Molecular analysis of ¨ the neutral ... C 335 (Ntp1p–Ha6H, Tps1p–Ha6H, Tpp1p–Ha6H) was obtained after mating strains C 33 and C5, and Southern and immunoblot analysis of germinated spores, as described above Expression of Tps1p–GST and ... identity with Tps1p and Tpp1p ranging from 34 to 42%, and that may be good candidates for additional interactions More remarkably, the degree of identity of these ORF products is also high with respect...

Ngày tải lên: 08/03/2014, 23:20

9 428 0
Báo cáo khoa học: Interaction of gymnemic acid with cyclodextrins analyzed by isothermal titration calorimetry, NMR and dynamic light scattering doc

Báo cáo khoa học: Interaction of gymnemic acid with cyclodextrins analyzed by isothermal titration calorimetry, NMR and dynamic light scattering doc

... )4.5 )4.4 )4.2 )4.7 3. 0 3. 2 3. 4 3. 6 3. 1 4 .3 ± 0.5 )7.7 )4.5 3. 2 Ka (· 105 3. 3 4.5 5.5 5.5 5.2 ± ± ± ± ± )1 M ) a b (kcalÆmol)1) The n-value represents binding stoichiometry of GA to c-CD The fitting ... correlate with the binding affinity between GA and the receptor 6158 The thermodynamic parameters obtained are in the range of those of other interactions with c-CD [15] The interaction of GA with ... rabbit glyceraldehyde -3- phosphate dehydrogenase and induce a smearing of its electrophoretic band and dephosphorylation FEBS Lett 579, 433 3– 433 6 FEBS Journal 272 (2005) 6154–6160 ª 2005 FEBS...

Ngày tải lên: 16/03/2014, 14:20

7 502 0
Báo cáo khoa học: A spectroscopic study of the interaction of isoflavones with human serum albumin pdf

Báo cáo khoa học: A spectroscopic study of the interaction of isoflavones with human serum albumin pdf

... Enzymol 33 5, 31 9 33 3 31 Maliwal BP, Appu Rao AG & Narasinga Rao MS (1985) Spectroscopic study of the interaction of gossypol with bovine serum albumin Int J Pep Protein Res 25, 38 2 38 8 ´ ´ 32 Zsila ... study) 3. 76 5.86 1.64 1 .35 1.56 1.57 6.58 1 .32 2.76 8 .35 9.28 · · · · · · · · · · · 10–14 10–16 10–14 10– 13 10– 13 10– 13 10–14 10–14 10–15 10)15 10)15 Ro (nm) r (nm) 2.08 1.55 2.54 3. 35 3. 43 3.44 ... absorption spectra of genistein (n) and daidzein (s) showing peak at 32 5 and 34 0 nm for genistein and daidzein, overlapping the emission maxima of 33 3 nm for HSA FEBS Journal 2 73 (2006) 451–467...

Ngày tải lên: 23/03/2014, 11:20

17 457 0
Báo cáo khoa học: Interaction of selenium compounds with zinc finger proteins involved in DNA repair pdf

Báo cáo khoa học: Interaction of selenium compounds with zinc finger proteins involved in DNA repair pdf

... Coordinating cysteines are numbered 105, 108, 126 and 129 in XPA and 5, 7, 13, 15, 19, 21, 24, 26, 29, 33 , 34 , 36 , 37 , 41, 44, 48, 50, 57, 59 and 60 in MT These structures are adapted from entries ... molecule of PM2, I ¼ the percentage of supercoiled PM2 DNA, and II ¼ the percentage of open circular PM2 DNA The overall number of strand breaks per 10 000 bp represents the sum of single-strand breaks ... content of MT by complete zinc release after oxidation with 10 mM H2O2 and ICP-MS revealed 6.4 zinc atoms per molecule of MT and negligible amounts of cadmium and copper Zinc release from XPAzf and...

Ngày tải lên: 30/03/2014, 15:20

10 374 0
Báo cáo Y học: Tryptophan fluorescence study of the interaction of penetratin peptides with model membranes pdf

Báo cáo Y học: Tryptophan fluorescence study of the interaction of penetratin peptides with model membranes pdf

... 34 7.0 34 7.0 34 5.0 33 6.0 33 6.5 33 9.0 230 137 0.67 0 .37 44 ND ND 13 11 ND 34 7.0 34 7.0 34 5.5 33 7.5 33 6.0 34 1.0 35 0 102 8.5 1.1 114 ND ND 12 ND 34 7.0 34 7.0 34 5.0 33 4.5 33 7.0 33 8.5 32 0 1 03 33 ... 0.42 0 .36 0.10 0.14 0.09 0.06 0.07 0.05 1.90 1 .33 1. 23 1.40 0 .37 0.10 0. 23 0.14 3. 40 4 .33 3. 63 4.06 0.44 0 .32 0.15 0.40 0.25 0 .38 0.82 0.78 0. 03 0.04 0.01 0.01 0.40 0.55 0. 13 0.18 ... aim of this study was to gain better insight into the mode of interaction of the penetratin peptide with lipid bilayers and to investigate the role of the Trp residues and the lipids in this interaction...

Ngày tải lên: 31/03/2014, 23:20

9 419 0
capture and utilization of carbon dioxide with polyethylene glycol

capture and utilization of carbon dioxide with polyethylene glycol

... temperatures from 31 3 to 34 8 K and at pressures up to 25 MPa [16] For the CO2-saturated PEG400 at 31 3.25, 33 2.89 and 34 7.77 K, a minimum viscosity of about MPa s at 25 MPa is obtained at 31 3.25 K, corresponding ... mixtures at 30 3.15, 31 3.15 and 32 3.15 K at pressures up to MPa are measured, and the mass ratios of PEG200 to the alcohols are 1:0, 3: 1, 1:1, 1 :3 and 0:1, respectively [22] The solubility of CO2 in ... SiR6R7R8 SiMe3 SiMe3 SitBuMe2 SitBuMe2 SiMe3 SiMe3 SiMe3 SiMe3 SitBuMe2 SitBuMe2 SiMe3 SitBuMe2 SitBuMe2 SiMe3 R5 R3 R4 Yield/% 72 85 97 74 75 91 95 39 68 63 89 67 44 78 (8 MPa) Scheme 3. 11 Mannich-type...

Ngày tải lên: 29/05/2014, 23:43

87 417 0
Báo cáo sinh học: " Modulation of macrophage functions by sheeppox virus provides clues to understand interaction of the virus with host immune system" docx

Báo cáo sinh học: " Modulation of macrophage functions by sheeppox virus provides clues to understand interaction of the virus with host immune system" docx

... h 3d 6d 9d 12 d Inac.SPPV Atenu SPPV 13. 3 ± 1.65 12.5 ± 2.8 10.2 ± 1.79 52 .3 ± 19.1 47.6 ± 8.5 13. 6 ± 1.22 10.82 ± 2.21 107.7 ± 25 * 2 53. 3 ± 33 .4** 266 ± 26.6** 12.8 ± 1 .35 133 ± 23. 1** 1 43. 7 ... Med 1989, 170:2081-2095 Page of (page number not for citation purposes) Virology Journal 2005, 2:22 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 Frucht DM, Fukao T, Bogdan ... amounts of SPPV induced enhancement of IL-12 due to ability of IL12 to induce early phase of NK and T cell activation [34 ] Using CRBC as model of TD Ag, it has been shown that SPPV was capable of...

Ngày tải lên: 18/06/2014, 22:20

7 353 0
báo cáo hóa học:" Modulation of macrophage functions by sheeppox virus provides clues to understand interaction of the virus with host immune system" doc

báo cáo hóa học:" Modulation of macrophage functions by sheeppox virus provides clues to understand interaction of the virus with host immune system" doc

... h 3d 6d 9d 12 d Inac.SPPV Atenu SPPV 13. 3 ± 1.65 12.5 ± 2.8 10.2 ± 1.79 52 .3 ± 19.1 47.6 ± 8.5 13. 6 ± 1.22 10.82 ± 2.21 107.7 ± 25 * 2 53. 3 ± 33 .4** 266 ± 26.6** 12.8 ± 1 .35 133 ± 23. 1** 1 43. 7 ... Med 1989, 170:2081-2095 Page of (page number not for citation purposes) Virology Journal 2005, 2:22 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 Frucht DM, Fukao T, Bogdan ... amounts of SPPV induced enhancement of IL-12 due to ability of IL12 to induce early phase of NK and T cell activation [34 ] Using CRBC as model of TD Ag, it has been shown that SPPV was capable of...

Ngày tải lên: 20/06/2014, 04:20

7 609 0
Báo cáo y học: "Clinical response to discontinuation of anti-TNF therapy in patients with ankylosing spondylitis after 3 years of continuous treatment with infliximab" ppsx

Báo cáo y học: "Clinical response to discontinuation of anti-TNF therapy in patients with ankylosing spondylitis after 3 years of continuous treatment with infliximab" ppsx

... duration of response to the initial treatment Of the 42 patients, 10 had to be retreated within 12 weeks after discontinuation of infliximab infusions, 37 within 24 weeks, and 38 within 36 weeks ... >3 for 13 (31 %) of the 42 patients and >4 for (19%) of the 42 The latter were still receiving treatment, because they had experienced a significant decrease of their BASDAI values, of about 30 % ... analysis of the disease status at TP1, there was also a difference between the patients with low (BASDAI

Ngày tải lên: 09/08/2014, 06:22

6 408 0
báo cáo khoa học: "Interaction of silver nanoparticles with HIV-1" pdf

báo cáo khoa học: "Interaction of silver nanoparticles with HIV-1" pdf

... http://www.jnanobiotechnology.com/content /3/ 1/6 35 36 37 38 39 40 41 42 43 Gelderblom HR, Hausmann EHS, Ozel M, Pauli G, Koch MA: Fine structure of human immunodeficiency virus (HIV) and immunolocalization of structural ... purposes) Journal of Nanobiotechnology 2005, 3: 6 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 Zhou Y, Yu SH, Cui XP, Wang CY, Chen ZY: Formation of Silver Nanowires by a Novel Solid-Liquid ... 1997, compiled by Division of AIDS of the National Institute of Allergies and Infectious Diseases and the National Institute of Health, and Collaborators Aliquots of cell-free culture viral supernatants...

Ngày tải lên: 11/08/2014, 00:22

10 300 0
báo cáo khoa học: " Interaction of silver nanoparticles with Tacaribe virus" pot

báo cáo khoa học: " Interaction of silver nanoparticles with Tacaribe virus" pot

... f) with b, d, and f being zoomed-in images of the white squares of a, b, and c Images g and h depict virus and the Ag-NPs localizing within the same cell, and i and j depict the interaction of ... 658 (0.261) 830 (0.214) 986 (0.217) (c) 10 μg NP + TCRV (PDI) 5 03 (0 .33 4) 481 (0.444) 32 6 (0 .36 6) 30 5 (0 .34 4) (d) 50 μg NP + TCRV (PDI) 974 (0.465) 756 (0.462) 524 (0 .38 8) 426 (0.4 03) The size ... 10 and 25 μg/ml, and was almost undetectable at concentrations of 50 μg/ml and greater (Fig 2) However, the 25 nm PSAg had out of replicates with detectable virus titers at 50 μg/ml and out of...

Ngày tải lên: 11/08/2014, 00:22

9 311 1
báo cáo khoa học: " A compatible interaction of Alternaria brassicicola with Arabidopsis thaliana ecotype DiG: evidence for a specific transcriptional signature" pdf

báo cáo khoa học: " A compatible interaction of Alternaria brassicicola with Arabidopsis thaliana ecotype DiG: evidence for a specific transcriptional signature" pdf

... AT4G02520.1 AT1G26110.1 AT4G 231 00.1 AT2G32870.1 AT3G50820.1 AT3G46010.1 AT1G7 031 0.1 AT4G31500.1 AT3G49620.1 AT5G66400.1 AT1G6 436 0.1 AT3G0 739 0.1 AT1G2 436 0.1 AT5G6 036 0.2 no no no no no yes no yes ... brassicicola-Brassica oleracea interaction Molec Plant Pathol 2006, 7(2):1 13- 124 Page 10 of 11 (page number not for citation purposes) BMC Plant Biology 2009, 9 :31 30 31 32 33 34 35 36 http://www.biomedcentral.com/1471-2229/9 /31 ... AT5G38410.1 AT3G 037 80.2 AT4G3 234 0.1 AT5G09660.2 AT5G24210.1 no no no no no no no AT4G16260.1 yes AT4G21960.1 AT3G4 836 0.1 AT1G12780.1 AT1G47128.1 AT3G61470.1 AT3G56200.1 AT5G 230 40.2 AT1G 233 10.2 AT5G02020.2...

Ngày tải lên: 12/08/2014, 03:20

11 197 0
Báo cáo y học: "Highly specific inhibition of leukaemia virus membrane fusion by interaction of peptide antagonists with a conserved region of the coiled coil of envelope" potx

Báo cáo y học: "Highly specific inhibition of leukaemia virus membrane fusion by interaction of peptide antagonists with a conserved region of the coiled coil of envelope" potx

... PBLV -39 1 PBLV-ΔN PBLV-ΔC PBLV-L/A PBLV-L404/410A PBLV-ΔCCF PBLV-R403A C34 Amino Acid Position gp21 400–429 gp21 400–429 gp30 39 1–419 gp30 400–419 gp30 39 1–410 gp30 39 1–419 gp30 39 1–419 gp30 39 4–419 ... inhibitory activity of gp41 peptides Proc Natl Acad Sci USA 1998, 95:9 134 -9 139 http://www.retrovirology.com/content/5/1/70 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 Malashkevich ... -GWMEWDREINNYTSLLIHSLIEESQNQQEKNEQELL MW Maximum Solubility (μM)* 3, 411 3, 200 3, 447 2 ,31 2 2 ,31 7 3, 236 3, 321 3, 052 3, 321 4,418 > 90.00 45.00 > 90.00 > 90.00 > 90.00 45.00 > 90.00 11.25 22.50...

Ngày tải lên: 13/08/2014, 05:21

14 285 0
Investigation of the interaction of antimicrobial peptides with lipids and lipid membranes 1

Investigation of the interaction of antimicrobial peptides with lipids and lipid membranes 1

... Spectroscopy (FCS) 3. 2.2 Setup of FCS 3. 2 .3 System calibration 3. 3 Langmuir film balance 3. 3.1 Comparison of monolayer and bilayer 3. 3.2 Principle of surface chemistry 3. 3 .3 Realization of the surface ... measurement 3. 3.4 Instrumentation 39 39 39 39 46 47 50 50 51 52 53 CHAPTER DETERMINATION OF CRITICAL MICELLE CONCENTRATIONS AND AGGREGATION NUMBERS OF DETERGENT AND LPS 4.1 Introduction 4.2 Materials and ... Introduction 5.2 Materials and methods 5 .3 Results 5 .3. 1 Calibration of the FCS setup 5 .3. 2 Solubility of V4-TMR 5 .3. 3 Binding of V4-TMR to LPS 5 .3. 4 Binding of unlabeled V4 to FITC-LPS 5 .3. 5 Attachment...

Ngày tải lên: 14/09/2015, 21:54

92 332 0
Investigation of the interaction of antimicrobial peptides with lipids and lipid membranes 2

Investigation of the interaction of antimicrobial peptides with lipids and lipid membranes 2

... exhibited an F2 of 4.2 % and an increase in the fluorescence yield compared to TMR of Q2/Q1 of 3. 21 90 Fig 5.5 Comparison of ACFs of V4-TMR and the complexes of V4-TMR with LPS, lipid A and PC The ... power of 10 µW The emission light was filtered by a dichroic filter (505DRLP) and an emitter ( 530 DF30) Interaction of V4-TMR with lipid A and PC Lipid A and PC were dissolved in PBS respectively and ... The mixture of V4-TMR and lipid A or PC was incubated for at least hours for FCS experiments Interaction of V4-TMR with SUVs The procedure is similar to that of interaction of V4- TMR with LPS The...

Ngày tải lên: 14/09/2015, 23:32

63 187 0
MOLAR HEAT CAPACITY UNDER CONSTANT VOLUME OF MOLECULAR CRYOCRYSTALS OF NITROGEN TYPE WITH HCP STRUCTURE CONTRIBUTION FROM LATTICE VIBRATIONS AND MOLECULAR ROTATIONAL MOTION

MOLAR HEAT CAPACITY UNDER CONSTANT VOLUME OF MOLECULAR CRYOCRYSTALS OF NITROGEN TYPE WITH HCP STRUCTURE CONTRIBUTION FROM LATTICE VIBRATIONS AND MOLECULAR ROTATIONAL MOTION

... 95.9247 , kxy = 4ε a a2 286 .37 22 σa − 64.7487 , γ = − 4ε a3 6288.912 σa − 4 73. 6748 , τ2 = 4ε a4 8 133 .888 σa − 737 .35 2 , τ4 = 4ε a4 1 131 5.6064 σa − 1006.0428 , τ6 = 38 4.711 σ 229.8912 σa − 66.9288 ... thermodynamic properties of molecular cryocrystals of nitrogen type Table Values of B and U0 for β−N2 and β−CO crystals Crystal B (K) U0 (K) β−N2 2.8751 32 5.6 β−CO 2.7787 688.2 Table Values of η at various ... N12θ Xkz z+5 3k14 (Xz + 1) + (τ2 +τ 2 (X + 2) + k k 18k kx3 z x x z 2γ2 4 τ τ + N12θ 15k1 (Xz + 1)2 + 3k25 k2 X (X + 2) + X+5 + (4τ4 +6τk58 +3 6 )γ X + z x z x 32 γ 2 τ22 3 N θ τ 23 γ 4 N θ5 γ...

Ngày tải lên: 31/10/2015, 10:41

7 252 0
THERMODYNAMIC PROPERTIES OF MOLECULAR CRYOCRYSTALS OF NITROGEN TYPE WITH FCC STRUCTURE CONTRIBUTION FROM LATTICE VIBRATIONS AND MOLECULAR ROTATIONAL MOTION

THERMODYNAMIC PROPERTIES OF MOLECULAR CRYOCRYSTALS OF NITROGEN TYPE WITH FCC STRUCTURE CONTRIBUTION FROM LATTICE VIBRATIONS AND MOLECULAR ROTATIONAL MOTION

... rotational free energy of the system of non -interaction rotators and is one of angles determining the position of symmetric axe of molecular field for the coordinate system of crystal In self-consistent ... 32 5.6 688.2 Table Values of η at various temperatures for α − N2 T(K) 10 15 20 24 28 30 32 34 η 0.8 633 0.8617 0.8544 0.8404 0.8244 0.8 038 0.7916 0.7778 0.7621 Table Values of η at various temperatures ... values of B, U0 and the values of η at various temperatures are given in Tables 1- [9] Table Values of B and U0 for crystals of N2 type Crystal α − N2 α − CO B(K) 2.8751 2.7787 U0 (K) 32 5.6 688.2...

Ngày tải lên: 31/10/2015, 10:44

7 278 0
Interaction of burkholderia pseudomallei with cells of the immune system

Interaction of burkholderia pseudomallei with cells of the immune system

... after exposure to TCR or antigenic stimuli 63 2 .3 3.1 3. 2 3. 3 3. 4 3. 5 3. 6 3. 7 3. 8 3. 9 3. 10 4.1 4.2 4 .3 4.4 4.5 4.6 4.7 4.8 4.9 4.10 Costimulatory effects of B pseudomallei flagellin protein on IL-2 ... Costimulatory effects of LPS and PAM3CysSK4 on IL-2 secretion by primary human CD4+ and CD8+ T cells 97 Effects of flagellin and PAM3CysSK4 on NF-κB activation in HEK293T cells transfected with TLR2 plasmid ... 24 hours of infection (Fig 2.2) Thus, I compared the cell viability of B3Z T cells and Jurkat T cells with DC2.4 cells When B3Z T cells were infected at MOI 5:1 and 30 :1, cell viability of infected...

Ngày tải lên: 08/11/2015, 16:31

139 215 0
w