2 analysis of laminar forced convection in a long tube

... Contracts 21 2. 4 .2 Characteristics of Contracts 22 2. 4 .2. 1 Modality 22 2. 4 .2. 2 Airtightness and Accurateness 23 2. 4 .2. 3 Inclusiveness 24 2. 4 .2. 4 Performativity ... and result of the study A fruitful data analysis, at first, asks for a good management of qualitative and quantiative data because there is a fact that data not only prove 29 theories, they are ... able to generate and supplyment theory as well Below are the main procedures for data analysis: - The data analysis was based on the quantitative and the qualitative data to point out the main...

Ngày tải lên: 26/11/2013, 13:26

... (Signature and Seal) (Signature and Seal) Full name of the representative Full name of the representative 4 .2 LEXICAL FEATURES OF ECAs AND VCAs 4 .2. 1 Archaic Words In ECAs we can find such archaic ... from 25 to 30 ones in VCAs were chosen 3.4 DATA COLLECTION 3.5 DATA ANALYSIS One hundred official collective agreements are collected for - Analyzing data: ECAs and VCAs are analyzed in terms of ... aware of the abilities of nominalization to create clarity and inclusiveness, ECAs drafters always pay attention to employ nominalization in their writing According to the survey, nominalization...

Ngày tải lên: 26/11/2013, 13:30

... language, individuals establish and maintain social identity and relationships The study of language in use, Discourse analysis, has become a new area of language investigation since the early ... discourse, and successful take part in that complex activity called conversation, we are undertaking what is known discourse analysis [ 12, p.iii] 2. 2 .2 Genre Analysis and Approaches to Genre Genre analysis ... Essay 2. 2.4.1 Essays According to modern linguists such as Oshima and Hogue [43, p.76], an essay is defined as a piece of writing several paragraphs long instead of just one or two paragraphs...

Ngày tải lên: 26/11/2013, 13:31

... Proceedings of the 20 03 Association for Business Communication Annual Convention Copyright 20 03, Association for Business Communication Taiwan, China, Japan, Indonesia and Singapore, etc) .Of these, 82 ... communication Her research interests focus primarily on the comparative analysis of organizational communication in multinational corporations; and secondly, the teaching of professional communication ... tests and to obtain more accurate results, the researcher attempted to control and adjust the factors (that is, to treat them as covariates and keep them constant) by using analysis of covariance...

Ngày tải lên: 09/12/2013, 16:15

... (8) (a) assistance from MOTU 12 (b) failure of amplifier (c) cause of casualty (d) completion of assistance cessed By utilizing the semantic patterns that are derived from a sublanguage analysis, ... 10 82 [Levi 1078] Levi, J.N The Syntaz and Semantics of Complez Nominals, Academic Press, New York [Marsh 19 82] Marsh, E and N Sager Analysis and Procussing of Compact Text Proc COLING 82, 20 1 -20 6, ... mechanism, based partially on the analysis presented here, on Navy messages in the near future Acknowledgments This research was supported by the Oflace of Naval Research and the Ofllce of Naval...

Ngày tải lên: 08/03/2014, 18:20

... graduated-rate income taxes are about as fair as a flat tax — and some nominally graduated state income taxes are actually less progressive than some flat-rate taxes The level of graduation in ... element in most state and local tax systems Because sales taxes are levied at a flat rate, and because spending as a share of income falls as income rises, sales taxes inevitably take a larger share ... permanently increased their state sales tax rate Arizona, Arkansas, California, Hawaii, Kansas, and Nevada all temporarily increased the sales tax Other Notable Changes • A dozen states either adopted...

Ngày tải lên: 23/03/2014, 20:20

... meaningful analysis as compared to the industry in China Throughout this study, figures for coated paper manufacturing in China and the U.S are drawn from an analysis of industry software called ... According to an analysis of World Trade Atlas 20 07 data, the leading producers of BSKP for China are China (36%), Canada ( 12% ), Chile ( 12% ), the U.S (11%), Russia (10%), Finland (4%), and New Zealand ... mills, and a small amount of imported pulp comes from Canada Model for the BHKP supply chain for China According to an analysis of World Trade Atlas 20 07 data, the leading producers of BHKP for China...

Ngày tải lên: 24/03/2014, 05:20

... (Roche Diagnostics, Meylan, France) and AAP determination was measured using storage method and colorimetric assay NAG and AAP activity (U/L) was expressed as a ratio with urinary creatinine (mmol/L) ... (PNF) of the graft was defined as a total absence of urine output for consecutive days after transplantation and since dialysis is not available in our animal facility, animals with PNF were sacrificed ... assay in the urine was invaluable Alanine aminopeptidase and b-N-acetylglucosaminidase are found in kidney tubular cells brush border and their presence in urine is a commonly accepted sign of...

Ngày tải lên: 18/06/2014, 19:20

... article as: Maleddu et al.: The role of mutational analysis of KIT and PDGFRA in gastrointestinal stromal tumors in a clinical setting Journal of Translational Medicine 20 11 9:75 Page of Submit ... Oncol Rep 20 06, 16:97-101 Wakai T, Kanda T, Hirota S, Ohashi A, Shirai Y, Hatakeyama K: Late resistance to imatinib therapy in a metastatic gastrointestinal stromal tumour is associated with a second ... Italian Sarcoma Group; Australasian GastroIntestinal Trials Group: KIT mutations and dose selection for imatinib in patients with advanced gastrointestinal stromal tumors Eur J Cancer 20 06, 42: 1093-1103...

Ngày tải lên: 18/06/2014, 19:20

... (Roche Diagnostics, Meylan, France) and AAP determination was measured using storage method and colorimetric assay NAG and AAP activity (U/L) was expressed as a ratio with urinary creatinine (mmol/L) ... (PNF) of the graft was defined as a total absence of urine output for consecutive days after transplantation and since dialysis is not available in our animal facility, animals with PNF were sacrificed ... assay in the urine was invaluable Alanine aminopeptidase and b-N-acetylglucosaminidase are found in kidney tubular cells brush border and their presence in urine is a commonly accepted sign of...

Ngày tải lên: 20/06/2014, 03:20

... article as: Maleddu et al.: The role of mutational analysis of KIT and PDGFRA in gastrointestinal stromal tumors in a clinical setting Journal of Translational Medicine 20 11 9:75 Page of Submit ... Oncol Rep 20 06, 16:97-101 Wakai T, Kanda T, Hirota S, Ohashi A, Shirai Y, Hatakeyama K: Late resistance to imatinib therapy in a metastatic gastrointestinal stromal tumour is associated with a second ... Italian Sarcoma Group; Australasian GastroIntestinal Trials Group: KIT mutations and dose selection for imatinib in patients with advanced gastrointestinal stromal tumors Eur J Cancer 20 06, 42: 1093-1103...

Ngày tải lên: 20/06/2014, 03:20

... different applications and situations Expert input and decisions are often needed in determining the actual parameter values of R and D in specific applications, such as our particular case Based on ... 580 62 57803 Porosity (%) 20 .90 23 .00 22 .51 21 .47 22 .25 22 .64 22 .79 22 .80 22 .58 22 .93 T2 63333 63794 64041 64183 64370 64494 64450 64 323 64139 63916 fibrin/fibrinogen on the clot surface That is, at ... to apply the alpha shape algorithm [22 ] that selects a subset of the input points to define the “shape” boundary of an input point cloud based on a parameter α With different α values, one can attain...

Ngày tải lên: 21/06/2014, 19:20

... IIB-UTRSR dATCACTTTTAATGTGCTGGTAGAGG 63 PCR1 dGGAGAAACCATCATGCTGAG 4INM dCAATTTTGCTGCTATGGGC 52 IIA-R dAATCCCAGAAATTCTCCCG IIA-H dAATCCCAGAAATTCTCCCA IIIB-NA1F dCAGTGGTTTCACAATGTGAA IIIB-NA1R dATGGACTTCTAGCTGCACCG ... IIIB-NA2R dCTGTACTCTCCACTGTCGTT IIIB-NA2PR dCTGGCTTGCTGATGAAGATAC IIIB-NA2PR dGTAACGCTTNGGCACCACC IIB-UTRSF dTGGGGAGGACAGGGAGAT IIB-UTRGR dCAGAAGGTGCAGTCGGC 54 62 50 The mutation inserted into ... FcγRIIb contains an inhibitory motif in the cytoplasmic tail and abrogates cellular activation FcγRIIb may also play a role in maintaining peripheral B cell tolerance and prevention of autoimmunity...

Ngày tải lên: 09/08/2014, 07:20

... F.L analysed all study data and prepared the final manuscript B.S was involved in study design and drafting of the manuscript A. V performed statistical analysis of the study data and drafting of ... medical center has research collaborations with Varian Medical Systems (Palo Alto, CA) and GE Healthcare (Waukesha, WI) in the field of 4DCT scanning and respiration-gated radiotherapy Page of (page ... PTVroutine PTVgating vs PTVall phases 10 11 12 13 14 15 38.0 27 .1 29 .0 31.0 26 .1 28 .9 26 .2 20.5 28 .2 27.5 27 .6 25 .5 28 .8 23 .9 42. 8 4.1 (10.8%) 2. 2 (8.1%) 2. 0 (6.9%) 3.8 ( 12. 3%) 2. 2 (8.4%) -1.5 (-5 .2% )...

Ngày tải lên: 09/08/2014, 10:20

... patients and their siblings the result of perinatal trauma? Acta Psychiatrica Scandinavica 20 00, 101:1 42- 147 32 Orwin RG: A fail-safe N for effect size in meta -analysis Journal of Educational ... data were analysed using Comprehensive MetaAnalysis version 2, a dedicated meta -analysis programme (BioStat, Inc, Englewood, NJ) The analysis was based on all included studies and consisted of ... status of the participant (although adequate blinding is difficult to attain and this bias cannot be fully eliminated); and degree of age matching between comparison groups (see table 2) Data...

Ngày tải lên: 11/08/2014, 15:22

... ligase has a large central cleft, with the larger N-terminal adenylation domain containing the cofactor binding site and a Cterminal OB domain In contrast, the larger 671 residue E coli DNA ligase ... DNA is a conundrum; imagine a magician’s linking rings taken apart and reassembled without an obvious point for opening The clamp loaders, the magicians opening the PCNA rings, belong to the AAA ... polymerase accessory proteins J Biol Chem 20 08, 28 3 :22 838 -22 846 19 Chastain PD, Makhov AM, Nossal NG, Griffith JD: Analysis of the Okazaki fragment distributions along single long DNAs replicated...

Ngày tải lên: 11/08/2014, 21:21

... Rev5'TACCTCCTGGCTTCAACCAT; P5 CSFor5'GATGTTTTTGCTGCCATTGA, Rev5' GC TAATC CC AACCTCAGCAC; DnaJ-For5'GGAATACAGGAGGGG GA CAT, Rev5'CCTTTTGGGAGAACCAAACA; BADH-For5' TGGAAAATTGCTCCAGCTCT, Rev5'CTGGACCTAATCCC GTCAAA; ... Uehara N, Matsuda N, Tanaka Y, Ishikawa H, Baba S, Takabe T, Wada K, Ishii T: Molecular cloning and functional characterization of two kinds of betaine-aldehyde dehydrogenase in betaine-accumulating ... SOS1, a plasma membrane Na+/H+ exchanger in Arabidopsis thaliana, by SOS2 and SOS3 Proc Natl Acad Sci USA 20 02, 99:8436-8441 Mahajan S, Pandey G, Tuteja N: Calcium and Salt Stress Signaling in Plants:...

Ngày tải lên: 12/08/2014, 03:20

... 26 5 /28 5 29 1 [GenBank: ACJ03 428 .1] 29 0 /29 1 TC2 329 26 29 1 /29 1 TC296897 29 0 /29 1 18753 19008 317/337 29 1 /29 1 93 28 9 [GenBank: ACJ03517.1] 26 6 /29 4 10 28 6 [GenBank: AAA3 427 2.1] 28 4/3 02 TC280138 313/3 32 ... Gobaa et al [28 ] concluded that a protein over-expressed in double haploid lines containing a 1BL.1RS translocation was a gamma gliadin containing nine cysteines The identification of the protein ... bread wheat cv Chinese Spring and found a number of proteins with MWs in the gamma gliadin range that had nine cysteine residues Ferrante et al [27 ] verified that a gene encoding a gamma gliadin...

Ngày tải lên: 12/08/2014, 03:21

... management, statistical analysis and data interpretation RS was involved in study design, data analysis, and writing of the manuscript All authors read and approved the final manuscript Competing interests ... analysis and interpretation, and writing of the manuscript WK was involved in study design and data analysis BE was involved in study design and data collection UM was involved in data management, ... drotrecogin alfa (activated) initiation in treatment of severe sepsis: a database cohort study of hospital mortality, length of stay, and costs Curr Med Res Opin 20 07, 23 :23 5 -24 4 23 Wheeler A, Steingrub...

Ngày tải lên: 13/08/2014, 21:21

... MGCARQAFPWRRTIMKFYQKLLAATALVALMSGAASA 179 822 05 Transketolase MLCVPLPSGASSRKAA 179 821 41 ATP synthase F1, beta chain MAKAATPKTTAAAEA 179 828 26 DNA-binding protein HU alpha MPMNKNELVA 179 821 54* Leucine, isoleucine, valine, ... isoleucine, valine, threonine and alanine binding protein MGVPTMRKTLFSGVALAAVIAFGGSAWA 179831 92* General L-amino acid-binding periplasmic protein AAPJ precursor MKKTLMTGVLGAAALFGIASGASA 179 826 82 50S ribosomal ... proteins involved in a variety of essential cellular pathways, including nucleic acid, amino and fatty acid anabolism and catabolism, glycolysis, TCA cycle, pyruvate and selenoamino acid metabolism...

Ngày tải lên: 14/08/2014, 07:21