... cell lines used were HeLa cervical carcinoma cells, HepG2 hepatoma cells, K562 and YN-1 erythroleukemia cells, Jurkat T-lymphocyte cells, KG1 myeloid cells, H146 small cell lung cancer cells, ... comparison with the low expression of HO-1 protein, in H146 small cell lung cancer cells is of particular interest because small cell lung cancer is derived from the airway neuroepithelial body [41], ... cells) mRNA was detected in five of these cell lines, but hardly at all in the other three (K562 erythroleukemia, Jurkat T cell, and H146 small cell lung cancer), in which HO-1 protein was also...
Ngày tải lên: 19/02/2014, 05:20
... Role on the Network • The network devices that people are most familiar with are called end devices These devices form the interface between the human network and the underlying communication network ... implemented on the host The protocols are viewed as a layered hierarchy, with each higher level services depending on the functionality defined by the protocols shown in the lower levels H c vi n ... Local Area Network (LAN): An individual network usually spans a single geographical area, providing services and applications to people within a common organizational structure, such as a single...
Ngày tải lên: 12/12/2013, 14:15
Tài liệu In this lab, 2 ISDN routers are required. If ISDN routers are not available, review the lab to become familiar with the process. An Adtran Atlas550 ISDN emulator is used to simulate the switch/ISDN cloud. pdf
... confirm In the first line of the response will be: Reload requested by console After the router has reloaded the line prompt will be: Would you like to enter the initial configuration dialog? [yes/no]: ... Sydney(config-if)#dialer string 5551001 Step Associate dialer profiles a Finally, associate the Dialer Profiles with the Dialer Interfaces that will be used, when needed Create a Dialer Pool, and put the interfaces ... chart: • The hostname • The console • The virtual terminal • The enable passwords If there is a problem completing this, refer to the Network Address Translation (NAT) configuration lab Step...
Ngày tải lên: 21/12/2013, 19:15
Tài liệu Báo cáo khoa học: Hu-K4 is a ubiquitously expressed type 2 transmembrane protein associated with the endoplasmic reticulum ppt
... FWPAIDDGLRRATYERGVKVRLLISCWGHSEPSMRAFLLSLAALRDNHTHSDIQVKLFV FWPAIDDGLRRAAYERGVKVRLLISCWGHSDPSMRSFLLSLAALHDNHTHSDIQVKLFV YWPEIDNHLRKAVYERNVNVRLLISCWKNSRPSMFTFLRSLAALHSNTSHYNIEVKIFV LFWPYIEDELRRSAIDRQVSVKLLISCWQRSSFIMRNFLRSIAMLKSKN ... et al Hu-K4 A Hum Mur Xen K 4L dro p37 60 MKP KLMYQELKVPAEEPANELPMNEIEAWKAAEKKARWVLLVLILAVVGFGAL.MTQL MKP KLMYQELKVPVEEPAGELPLNEIEAWKAAEKKARWVLLVLILAVVGFGAL.MTQL MSS KVEYKPIQ.PHEEAENHFLQHELHKVKA.RKYYRCALVVAIIITLVFCIL.ASQL ... Hum Mur Xen K 4L Dro p37 301 360 LNGTPAL.AYLASAPPPLCPSGRTPDLKALLNVVDNARSFIYVAVMNYLPTLEFSHPHR LNGTPAL.AYLASAPPPLCPSGRTPDLKALLNVVDSARSFIYIAVMNYLPTMEFSHPRR LNSTASQ.VYLSSSPPPLSATGRTDDLQSIMNIIDDAKKFVYISVMDYSPTEEFSHPRR...
Ngày tải lên: 19/02/2014, 17:20
Cisco Systems - Scaling the network with NAT and Pat pot
... protocol inside global-ip global-port local-ip local-port [outside local-ip local-port global-ip global-port] • Clears an extended dynamic translation entry © 2002, Cisco Systems, Inc All rights reserved ... address translation entries Router#clear ip nat translation inside global-ip local-ip [outside local-ip global-ip] • Clears a simple dynamic translation entry containing an inside translation, or ... Overloading an Inside Global Address Example © 2002, Cisco Systems, Inc All rights reserved ICND v2.0—6-13 Clearing the NAT Translation Table Router#clear ip nat translation * • Clears all dynamic...
Ngày tải lên: 06/03/2014, 15:20
Developer''''s Guide to Building XML-based Web Services with the Java 2 Platform, Enterprise Edition (J2EE) pptx
... customized solution The mechanics of this collaboration will be completely transparent to the consumer, who will experience only the collective benefit delivered by the end result The XML standards ... and other enterprise-class systems, it is also a viable web services platform The web services development model with J2EE relies on the following two standard technologies: XML technologies The ... isolates you from the specifics of these protocols, enabling rapid application development There is no longer any need for developers to interact directly with the XML representation of the call...
Ngày tải lên: 14/03/2014, 23:20
programming the network with perl - wiley 2002
... readily available Linux provides excellent support to the Perl programmer All the code in Programming the Network with Perl should run unaltered on any Linux platform, regardless of the underlying ... Programming the Network with Perl uses local Controlling Flow 13 The inbuilt my subroutine can be used to give a variable container lexical scope The variable is not globally visible, nor is it visible ... refer to the instance data and methods The code above, assuming the ReallyDead module actually existed, would print the following: Elvis Presley really is dead 12 However, we will learn a little about...
Ngày tải lên: 25/03/2014, 10:29
Báo cáo Y học: Inhibition of SERCA Ca2+ pumps by 2-aminoethoxydiphenyl borate (2-APB) 2-APB reduces both Ca2+ binding and phosphoryl transfer from ATP, by interfering with the pathway leading to the Ca2+-binding sites ppt
... ICRAC in RBL-1 cells J Physiol 532, 55–71 Ma, H.T., Venkatachalam, K., Li, H.S., Montell, C., Kurosaki, T., Patterson, R .L & Gill, D .L (2001) Assessment of the role of the inositol 1,4,5-trisphosphate ... involved in stimulating the rate at which the ATPase cycles [31] The data was fitted to curves with the following kinetic parameters: In the absence of 2-APB, the catalytic Km was 9.4 ± 1.6 lM, with ... 2-APB with the Ca2+ ATPase The figure shows two possible sites of interaction for 2-APB with the ATPase, with the important residues highlighted and labelled A second potential site has also been located...
Ngày tải lên: 31/03/2014, 23:20
Báo cáo sinh học: "Genetic variability of the envelope gene of Type D simian retrovirus-2 (SRV-2) subtypes associated with SAIDS-related retroperitoneal fibromatosis in different macaque species" pot
... D2/CEL/OR MMLV HTLV-1 Ebola sdvqAISSTIQDLQDQVDSLAEVVLQNRRGLDLLTAEQGGICLALQEKCcfyank ddlrEVEKSISNLEKSLTSLSEVVLQNRRGLDLLFLKEGGLCAALKEECafyad~ kdisQLTQAIVKNHKNLLKIAQYAAQNRRGLDLLFWEQGGLCKALQEQCcflnit ... LDVFREMHQNTVLTEQTKALNTSATNPVIAIRDNVIFSSNTALSDVETTIFHSKTTVAAKSLRKGLKAIDQV LNVLQEMHQNTVLTEKTKAFKATADNPVVVIKNNILFFITIAFFDVETTILQNKTTVAAKRLRKGLKAIDQI LNVLREMHQNTVLTEKTKAFKATADNPVVVIKNNILFSINIAFFDVETTILQNKTTVAAKRLRKRLKAIDQI ILFSINIAFFDVETTILQNKATVAAKRLRKGLKAIDLV ... LDVFREIHQITVLTEQTKAFNTSATNPVIALRNNVLFSINIALSDVETTILHNKTTVAAKRLRKGLKAMDQV LDVFREIHQITVLTEQTKAFNTSATNPVIAIRNNVLFSINIALSDVETTILHNKTTVAAKRLRKGLKAMDQV LDVFREIHQITVLTEQTKAFNTSATNPVIAIRNNVLFSINIALSDVETTILHNKTTVAAKRLRKGLKAMDQV...
Ngày tải lên: 19/06/2014, 08:20
báo cáo hóa học:" Genetic variability of the envelope gene of Type D simian retrovirus-2 (SRV-2) subtypes associated with SAIDS-related retroperitoneal fibromatosis in different macaque species" pptx
... D2/CEL/OR MMLV HTLV-1 Ebola sdvqAISSTIQDLQDQVDSLAEVVLQNRRGLDLLTAEQGGICLALQEKCcfyank ddlrEVEKSISNLEKSLTSLSEVVLQNRRGLDLLFLKEGGLCAALKEECafyad~ kdisQLTQAIVKNHKNLLKIAQYAAQNRRGLDLLFWEQGGLCKALQEQCcflnit ... LDVFREMHQNTVLTEQTKALNTSATNPVIAIRDNVIFSSNTALSDVETTIFHSKTTVAAKSLRKGLKAIDQV LNVLQEMHQNTVLTEKTKAFKATADNPVVVIKNNILFFITIAFFDVETTILQNKTTVAAKRLRKGLKAIDQI LNVLREMHQNTVLTEKTKAFKATADNPVVVIKNNILFSINIAFFDVETTILQNKTTVAAKRLRKRLKAIDQI ILFSINIAFFDVETTILQNKATVAAKRLRKGLKAIDLV ... LDVFREIHQITVLTEQTKAFNTSATNPVIALRNNVLFSINIALSDVETTILHNKTTVAAKRLRKGLKAMDQV LDVFREIHQITVLTEQTKAFNTSATNPVIAIRNNVLFSINIALSDVETTILHNKTTVAAKRLRKGLKAMDQV LDVFREIHQITVLTEQTKAFNTSATNPVIAIRNNVLFSINIALSDVETTILHNKTTVAAKRLRKGLKAMDQV...
Ngày tải lên: 20/06/2014, 04:20
Báo cáo hóa học: " Research Article A Hilbert-Type Integral Inequality in the Whole Plane with the Homogeneous Kernel of Degree −2 Dongmei Xin and Bicheng Yang" pdf
... 2 Journal of Inequalities and Applications All of the above inequalities are built in the quarter plane Yang 10 built a new Hilbert-type integral inequality in the whole plane as follows: ∞ ∞ ... contradiction that the constant factor in the reverse of 3.1 is not the best possible Thus the theorem is proved By the same way of Theorem 3.3, we still have the following theorem Theorem 3.4 By the assumptions ... where the constant factor π is the best possible Zeng and Xie 11 also give a new inequality in the whole plane By applying the method of 10, 11 and using the way of real and complex analysis, the...
Ngày tải lên: 21/06/2014, 05:20
Báo cáo hóa học: " Research Article Average Throughput with Linear Network Coding over Finite Fields: The Combination Network Case" doc
... to deal with the valuation (defined below) induced by the network code rather than the network code itself Definition Given a network code, C, defined by a collection of functions fe , for all e ∈ ... at the source whose size does not exceed the smallest of the min-cuts between the source and each sink Linear network coding over sufficiently large field allows every sink t ∈ T to recover the ... and the proposition follows (37) EURASIP Journal on Wireless Communications and Networking From the work in [7] for q = and the results presented in this work, we obtain the following corollary...
Ngày tải lên: 21/06/2014, 23:20
Hướng dẫn cài đặt The Network Simulator - ns-2 pptx
... the installation places: tcl8.4.15: tk8.4.15: otcl: tclcl: /home/guru/ns-allinone-2.32/{bin,include,lib} /home/guru/ns-allinone-2.32/{bin,include,lib} /home/guru/ns-allinone-2.32/otcl-1.13 /home/guru/ns-allinone-2.32/tclcl-1.19 ... http://www.tracegraph.com/mglinstaller.gz bạn download về, giải nén gunzip mglinstaller.gz Bạn thấy file mglinstaller > đặt quyền thực thi cho chạy: chmod +x mglinstaller /mglinstaller Khi hỏi thư mục bạn đánh vào mgl ... ns-allinone-2.32 Chạy script cài đặt /install Sau chạy xong báo thành công.Nếu có l i xem Nam has been installed successfully Ns-allinone package has been installed successfully Here are the...
Ngày tải lên: 04/07/2014, 14:20
Easy PHP Websites with the Zend Framework (phần 2) pot
... install -o HTML_Table Some installation-related output will scroll by, followed by a message confirming successful installation That's it! You're ready to begin using HTML_Table Using HTML_Table ... otherwise easily with the standard PHP installation, such as provide SMTP authentication parameters Installing the Mail Package To install Mail, execute the following commands: %>pear install ... $table->toHtml(); Let's review some of this script's key lines: • Line 04 makes the HTML_Table package available to the script by "including it" into the document We'll talk more about the details...
Ngày tải lên: 05/07/2014, 17:20
Telephony - Chapter 2: Subscriber Access to the Telephone Network ppt
... bao t ng ñ ài Analog Digital ði n áp vào DC, c p ngu n ði n áp vào 75VAC, 25Hz Ring Relay SLIC Overvoltage (Subscriber Loop Protection Interface Circuit Circuit) RE (Ring Enable) PD Power Down ... tho i quay RL RT s ho c m ch chuông R Telephone Ressitor Tr kháng nh c máy R :: Line Resistor R : Current Limiting Resistor danh ñ nh: 400Ω Tr kháng ñ t máy danh ñ nh: 1600Ω T L CL Page Quay ... ngư c l i C n có tín hi u syn, clock vào Txclk Txsyn ENCODER Tx PCM out Ain Rx Aout DECODER HSO Rxclk Rxsyn Page 19 Giao ti p thuê bao t ng ñ ài Ch c sai ñ ng H (Hybrid) ðư c th c hi n b i SLIC...
Ngày tải lên: 27/07/2014, 07:20
Báo cáo y học: "Association of Adiposity, Cardiorespiratory Fitness and Exercise Practice with the Prevalence of Type 2 Diabetes in Brazilian Elderly Women" pot
... Inactive The WC ≤ 80cm Active group was the reference The significance level was established a priori at p < 0.05 for all analysis All analyses were performed using Statistical Package for the Social ... however, there are no recent investigations involving the Brazilian population The last available data in Brazil was published in 1998, showing that the prevalence of diabetes was 17.4% for elderly ... Results The prevalence of T2D in the sample was 16% Tables and show the results of the univariate logistic regression analysis, demonstrating the isolated association of each independent variable...
Ngày tải lên: 08/08/2014, 16:23
Some struture with the ing form 2 ppsx
... and the sun in our solar system We normally say: the country(side), the earth, the environment, the government, the moon, the ozone layer, the Prime Minister, the sea(side), the sky, the sun, the ... arrived in Cheltenham to look around the town Look again at the story and the examples in Unit 83 B The sun, etc When there is only one of the things we are talking about, we use the The sun was ... going down The government is unpopular A drive in the country would be nice We shouldn't pollute the environment Normally there is only one sun or one government in the context We mean the government...
Ngày tải lên: 09/08/2014, 07:22
Báo cáo khoa hoc:" The checkpointkinase 2 (CHK2) 1100delC germ line mutation is not associated with the development of squamous cell carcinoma of the head and neck (SCCHN)" potx
... organized the study and wrote most parts of the article GP collected the patient’s samples and isolated DNA MW wrote parts of the article, collected samples and investigated patients AC and TKH collected ... sample representing the wild type sequence of CHK2 Exon 10 served as control All samples underwent confirmation by repeated analysis Results The 91 investigated patients with histologically confirmed ... malignancy Secondary malignancy Number of Patients suffering from a secondary malignancy Esophagus Lung Basal Cell Carcinoma Bladder Prostate 3 Colon Chronic myeloid leukemia (CML) Chronic lymphocytic...
Ngày tải lên: 11/08/2014, 07:21
Báo cáo y học: "Relationship between inflammatory markers, metabolic and anthropometric variables in the Caribbean type 2 diabetic patients with and without microvascular complications" pptx
... mortality from cardiovascular disease [20] With respect to the lipid profile the following observations were made The cholesterol and LDL levels were unusually high in patients who were controls ... fasting blood and random urine samples were collected The red top tubes (without any anticoagulant) were used to collect the blood samples for the analysis of sialic acid,, CRP, total cholesterol, ... to the unrestricted diets of these patients as well as possible inactive lifestyles [23] The unexpectedly lower LDL levels in the diabetics with and without nephropathy may be attributed to a low...
Ngày tải lên: 11/08/2014, 08:21
báo cáo khoa học:" Validation of the "World Health Organization Disability Assessment Schedule, WHODAS-2" in patients with chronic diseases" ppt
... transforming them into a range from to 100, with higher scores indicating higher levels of disability A global score is also calculated from all the items (36) or from all except the Life activities ... and the Functional Disability Inventory for children[14]) Nevertheless, none of them has been developed with the clear ICF biopsychosocial conceptual model Previous studies have evaluated the ... disability based on the ICF model[9] There exist other tools that have traditionally been used to measure disability, such as the Indexes of activities of daily living (ADLs)[10], the Functional Limitations...
Ngày tải lên: 12/08/2014, 01:21