... ConstraintException is raised Two techniques can be used to load parent and related child data without error into a DataSet with a schema that includes data relations defined: • • Load data from the parent tables ... parent and child data adapters SqlDataAdapter daParent = new SqlDataAdapter("SELECT * FROM Orders", ConfigurationSettings.AppSettings["Sql_ConnectString"]); SqlDataAdapter daChild = new SqlDataAdapter( ... private DataSet ds; // private void HierarchicalDataSetForm_Load(object sender, System.EventArgs e) { ds = new DataSet( ); // Get the schema for the Orders table DataTable parentTable = new DataTable("Orders");...
Ngày tải lên: 24/12/2013, 05:15
... INSERT statement using that data • The Oracle database server accepts the data and executes the INSERT statement to store the data in the database D-26 Copyright © Oracle Corporation, 2002 All rights ... file Database datafiles D-9 Copyright © Oracle Corporation, 2002 All rights reserved Conventional and Direct Path Loads Instance SGA Shared pool Array insert Conventional Table Data save Space ... the datafile is organized as records A datafile can be in one of three formats: – Fixed-record format – Variable-record format – Stream-record format D-22 Copyright © Oracle Corporation, 2002 All...
Ngày tải lên: 23/03/2014, 00:20
Tài liệu Edit Data and Update Changes That Are Made to an ADO.NET pdf
... command for the DataAdapter object The DataAdapter Update method is called to update the dataset with the data changed and then the AcceptChanges of the DataSet object This accepts all the changes ... Create the LoadList routine by entering the following code into the form you created for this How -To This code creates and fills a data table using a data adapter The string that the data adapter ... SelectedItem from the list box, a data adapter is created, and a dataset is filled Next, the individual DataRow is created Last, each of the TextBox controls is loaded with the value from the column...
Ngày tải lên: 24/12/2013, 06:17
Economic Effects of Reducing the Fiscal Restraint That Is Scheduled to Occur in 2013 docx
... fiscal restraint scheduled to occur The agency analyzed an alternative fiscal scenario that reflects a combination of possible changes to current law, including changes that would maintain major ... calendar year basis because most of the policy changes are scheduled to take effect at the beginning of calendar year The Affordable Care Act comprises the Patient Protection and Affordable Care Act ... THE FISCAL RESTRAINT THAT IS SCHEDULED TO OCCUR IN 2013 expects—with the economy projected to contract at an annual rate of 1.3 percent in the first half of the year and expand at an annual rate...
Ngày tải lên: 15/03/2014, 20:20
how the use of the diary form narrative is beneficial to the
... descriptions, facts, that represents a group as a whole and the reader can feel as if they are part of the group and read, and think along with the characters Another thing dealing with the diary form is ... happen when the diary form of narrative is used For instance, after Lucy had written what was happening to her when her mother passed away, the story went back in time for another important matter ... The form lets dialogues take place, it lets many people altogether tell a story in first person, and it lets a reader be able to see densely detailed scenes through a person that isn't being a...
Ngày tải lên: 21/03/2014, 22:04
Semantics Semantics is the study of meaning that is used to understand human expression through language.
... Another fact dealing with this type is that a small elephant” for example, is much bigger than a big mouse” a Implicitly gradable pairs Another characteristic of certain pairs of gradable antonyms ... action In this case a ball Agent & theme The boy cut his hair with the scissors In this example, we can notice that there is a tool that helps the Agent to perform the action That is the semantic role ... Semantics is the study of meaning that is used to understand human expression through language Semantics is perhaps the most difficult part of the grammar of a language to learn What is “semantics”?...
Ngày tải lên: 13/07/2014, 23:26
Báo cáo y học: "Attributable cost of methicillin resistance: an issue that is difficult to evaluate" pps
... ventilator-associated pneumonia Crit Care 2006, 10:R97 Safdar N, Dezfulian C, Collard HR, Saint S: Clinical and economic consequences of ventilator-associated pneumonia: a systematic review Crit Care ... M, Garrouste-Orgeas M, Jamali S, Mourvillier B, De Lassence A, Descorps-Declere A, Adrie C, Costa de Beauregard MA, et al.: Is methicillin resistance associated with a worse prognosis in Staphylococcus ... potential means for protection against early-onset ventilator-associated pneumonia Clin Infect Dis 2004, 38:14011408 McCarthy EP, Iezzoni LI, Davis RB, Palmer RH, Cahalane M, Hamel MB, Mukamal K, Phillips...
Ngày tải lên: 13/08/2014, 01:20
Báo cáo khoa học: "Does Size Matter – How Much Data is Required to Train a REG Algorithm?" potx
... measures not necessarily correlate with similarity measures such as Dice Finally, it will be interesting to repeat Experiment II with Dutch data The D-TUNA data are cleaner than the TUNA data ... instance? In this paper, we address this question by systematically training the graph-based REG algorithm on a number of “semantically transparent” data sets of various sizes and evaluating on a held-out ... Corpora for Natural Language Generation: Language Generation and Machine Translation (UCNLG+MT), pages 90–92 Ruud Koolen and Emiel Krahmer 2010 The D-TUNA corpus: A Dutch dataset for the evaluation...
Ngày tải lên: 07/03/2014, 22:20
Báo cáo khoa học: Tumor necrosis factor-a converting enzyme is processed by proprotein-convertases to its mature form which is degraded upon phorbol ester stimulation pptx
... following antibodies were used: anti-ADAM10, a polyclonal rabbit antibody against endogenous ADAM10 and anti-TACE, and a polyclonal rabbit antibody against endogenous TACE (Chemikon International, ... 25–31 Takahashi, S., Kasai, K., Hatsuzawa, K., Kitamura, N., Misumi, Y., Ikehara, Y., Murakami, K & Nakayama, K (1993) A mutation of furin causes the lack of precursor-processing activity in human ... (5¢-GTGGGCCGGAAAGTGAGCCA-3¢) and Fur2_rev (5¢-CCCTTGTAGGAGATGAGGCC-3¢) The resulting 1058 bp amplificate was isolated, subcloned in pUC57 (MBI Fermentas) and sequenced Western blot analysis of TACE and ADAM10...
Ngày tải lên: 08/03/2014, 02:20
Báo cáo khoa học: Molecular characterization of a novel nuclear transglutaminase that is expressed during starfish embryogenesis ppt
... ACATGTACATGTATATCACTTTGAACTGGTTTTCATTAAAAAAAAAAAACCATCAATTTG AGAAGAAACAATTACTTCTTAAGTCAATTAATTTTTCTAGAAATGCAAAAGATATTCCCC TTAACAGCTGTTTGAAATGAGGCCTCGGTCTCAAGTTTAAGAGTGCCCCCATATGTAAGC TAAAAAGCTCCAGGAAGTTGACCCAGAAGAAATTTGTTAAGAGTTCACGGATAAGCAAGG ... A H V T L N V K S A * ATGCGAGGTCAGCATTTATCCAACCAGAAGCTTCACGGAGCTAGCTGGGCAAGGAAATTT GATAATCGCAAGAAATAATTTCCCCCCAAAAACAAAAGGTTGTTGGCTGAAAATACTTCT ACATGTACATGTATATCACTTTGAACTGGTTTTCATTAAAAAAAAAAAACCATCAATTTG ... TAAAAAGCTCCAGGAAGTTGACCCAGAAGAAATTTGTTAAGAGTTCACGGATAAGCAAGG TATTTGGATAAGGTGCATTTGTACATTTTGTGTGTACTGGTTTAGTGTAGAATTTAATTT TTTTTGGTTAATTCTGTCACAAGAACATAATTCTATGGTTACTACACAATGTTGCATCCC AACGCCACCTTTTTATTTTTAATCATATATCATCTCAGTGAAGGTCAGTCCTTG...
Ngày tải lên: 08/03/2014, 10:20
Báo cáo khoa học: The b domain is required for Vps4p oligomerization into a functionally active ATPase potx
... 5¢-CGCTGCAGTAAGAGCAGTAAACCCG-3¢ 5¢-GAGAATCAGTGTCGACTTCATCTATAAAAATAATAGAAGGTTTATT-3¢ 5¢-GCCCATATTCGTCGACGCGCTAACAGGTACCAGAGGAGAAGGAGAGAGCGAAGCAAGTAG-3¢ 5¢-GGGCGGATCCTCTGCTTTTCTTTATC-3¢ 5¢-GCGCTAATGCAACCGTAGTCAATTGATTAACGTGCT-3¢ ... 5¢-GCGCTAATGCAACCGTAGTCAATTGATTAACGTGCT-3¢ 5¢-AGCACGTTAATCAATTGACTACGGTTGCATTAGCGC-3¢ 5¢-TTAAAAGAACCAGATTAGTCAATTGATTAACGTGCT-3¢ 5¢-AGCACGTTAATCAATTGACTAATCTGGTTCTTTTAA-3¢ 5¢-AAGCAAGAACAGTTCACTGCAGCTTTTGGTCAAGCAGGTAACTAGTCAATTGAT-3¢ ... 5¢-AAGCAAGAACAGTTCACTGCAGCTTTTGGTCAAGCAGGTAACTAGTCAATTGAT-3¢ 5¢-ATCAATTGACTAGTTACCTGCTTGACCAAAAGCTGCAGTGAACTGTTCTTGCTT-3¢ 5¢-GCGCTAATGCAACCGATAGATGTCTCTACGGAGGAC-3¢ 5¢-GTCCTCCGTAGAGACATCTATCGGTTGCATTAGCGC-3¢ 5¢-GACGACGAAACAAGAAAAGATGGCGCCATCGAGATG-3¢...
Ngày tải lên: 16/03/2014, 13:20
Báo cáo khoa học: The Drosophila jumonji gene encodes a JmjC-containing nuclear protein that is required for metamorphosis pot
... exponential amplification Primer sequences used were as follows: cycD-F, 5¢-GGGATCCCA CATTGTATTCG-3¢; cycD-R, 5¢-ACGGAGCTTTGAAG CCAGTA-3¢; cycE-F, 5¢-AAGGTGCAGAAGACGCA CTT-3¢; cycE-R, 5¢-AATCACCTGCCAATCCAGAC-3¢; ... 5¢-AATCACCTGCCAATCCAGAC-3¢; cdk4-F, 5¢-TACAACAGCACCGTGGACAT-3¢; cdk4-R, 5¢-TGGGCATCGAGACTATAGGG-3¢; rp49-F, 5¢-CGG ATCGATATGCTAAGCTG-3¢; and rp49-R, 5¢-GAACG CAGGCGACCGTTGGGG-3¢ Acknowledgements We would like to ... Df(3L)AC1 animals also exhibited larval and pupal lethality and displayed similar phenotypes as homozygous djmje03131 mutants (Fig 5A and data not shown), confirming that djmje03131 is a loss...
Ngày tải lên: 23/03/2014, 07:20
Báo cáo khoa học: A designed curved DNA segment that is a remarkable activator of eukaryotic transcription potx
... TTTTTCAGTCAGTTTTTCAGTCAGTTTTTCAC-3¢ and 5¢-GTGAAAAACTGACTGAAAAACTGACTGAAAAAC TGACTGAAAAACTGA-3¢ were annealed to generate a dsDNA fragment, which we named T4-R¢¢ T4-R¢¢ was inserted into the PmaCI site ... obtained by annealing oligonucleotides 5¢-GTTTTTCATG TTTTTCATGTTTTTCATGTTTTTCAC-3¢ and 5¢-GTG AAAAACATGAAAAACATGAAAAACATGAAAAAC-3¢, Synthetic oligonucleotides 5¢-TCAGTTTTTCAGTCAG TTTTTCAGTCAGTTTTTCAGTCAGTTTTTCAC-3¢ ... Designed DNA as an activator of transcription N Sumida et al transient transfection assay system, at a specific rotational phase and distance between T4 and the promoter [12] We concluded that T4 formed...
Ngày tải lên: 23/03/2014, 10:20
Báo cáo khoa học: NARG2 encodes a novel nuclear protein with (S/T)PXX motifs that is expressed during development docx
... cata ag ATGTCC AAGGAC gt aagt … ttaa ag GATTGC AGAAGA gt aagt … ttgc ag CAATTT ATGTTG gt aagt … tttt ag GGCATA ACTCAA gt aaga … tatc ag GATTTC AAGTAG gt aagt … attt ag CTTGCA CAAAAG gt aaga … ... ag ATGCCC AAGGAC gt aagt … ttca ag GATTGC AGAAGA gt aagt … ttgc ag CAATTT ATGTTG gt gagt … tttt ag GGCATA ACTCAA gt aagg … taat ag GATTTC ATGTAG gt aagt … atgc ag CTTGCA GCAAAG gt aaga … tcta ag ... ag ACGTAT TACTTG gt atgt … aatc ag GATATG ACAGAG gt aaaa … tctc ag AAAATT GCATTG gt aagg … attt ag GGCAGT CATTAT gt aagt … tttc ag GATATT TTGCAG gt ttgt … ttta ag GTTCAA ATGGAC gt atgt … cata...
Ngày tải lên: 23/03/2014, 13:20
Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf
... QLQRDALRHFAPCPPRARGLQEARVALEPALEPGFAARLQAQRICLERADAGPLGVAGS RAT R3E 119 QLQRDALRHFAPCPPRTRGLQDARIALEPALEPGFAARLQAQRICLERADAGPLGVAGS HUMAN R3E 119 QLQRDALRHFAPCQPRARGLQEARAALEPASEPGFAARLLTQRICLERAEAGPLGVAGS PP1 ... ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPSPPRADRFAFRLPAPPVGGTLLF RAT R3E 178 ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPAPPRADRFAFRLPAPPVGGALLF HUMAN R3E 178 ARVVDLAYEKRVSVRWSADGWRSQREAPAAYAGPAPPPPRADRFAFRLPAPPIGGALLF GM/ RGL/R 3A ... gacgaggcgcctgcggccgacggcggaaaacaccaaaggcacccgggggcggggcgacccgatgtggcggggaggagtag 920 I H F I * 279 921 gagagaccaggattggcgggagcggtccaagggagtc 957 Fig (A) Diagram of human PPP1R3E mRNA compared with PPP1R3E...
Ngày tải lên: 30/03/2014, 16:20
Báo cáo Y học: A nonphosphorylated 14-3-3 binding motif on exoenzyme S that is functional in vivo pot
... primer pair pexoSa (forward): 5¢-CGGAGAAACTCGAGGAGAAGGCAACCATC-3¢, pexoSb (reverse): 5¢-GTCTTTCTGGTACCACCGGTCA GGCCAGA-3¢ pMF419 and pMF420 were obtained by replacing the C-terminal ClaI/KpnI fragment ... We have shown earlier that Ras (and its deactivation of downstream targets such as Erk and PKB/Akt), and many other small GTPases are modified by ExoS, expressed and translocated into the eukaryotic ... seven isoforms (b, f, s, r, e, g and c) using a BiometraTM slot blot apparatus A summary of these antisera is shown in Table and [41] (A) Whole HeLa cell lysate HeLa cell lysates were subjected to...
Ngày tải lên: 31/03/2014, 08:20
the nothing that is, a natural history of zero - robert kaplan
... karikara, vivara, achobya, vivaha, utsanga, bahula, nagabala, titilambha, vyavaithanaprajnapti (! that' s 1031), and so through the alluring samaptalambha (1037) and the tongue-twisting visandjnagati ... and 1087, you have to say that Archimedes' estimate wasn't all that bad This is a spectacular application of the Greek insight that the world afar can be grasped by analogy to the world at hand ... Bogota Buenos Aires Calcutta Cape Town Chennai Dar es Salaam Delhi Florence Hong Kong Istanbul Karachi Kuala Lumpur Madrid Melbourne Mexico City Mumbai Nairobi Paris Sao Paulo Singapore Taipei Tokyo...
Ngày tải lên: 05/06/2014, 11:23
báo cáo hóa học: " Integration of immigrants into a new culture is related to poor sleep quality" pptx
... translated into Portuguese by professional translators and translated back into German by the accompanying translators The interview was identical to the one given to the Moroccan women Internal ... of the study, participated in its coordination and the statistical analysis, and helped to draft the manuscript All authors read and approved the final manuscript Additional material http://www.hqlo.com/content/6/1/61 ... middle age We can only speculate whether this finding is related to cultural or nutritional factors It is also possible that the generally more active hypothalamic-pituitary-adrenal axis in women...
Ngày tải lên: 18/06/2014, 19:20