11 have—and listen to—a trusted mentor
Tài liệu Preparedness and Response to a Mass Casualty Event Resulting from Terrorist Use of Explosives pdf
... patients Provide appropriate transportation and distribution of patients Manage fatalities 9 10 11 11 11 11 12 12 12 13 13 13 14 14 14 14 15 15 16 16 16 CHAPTER FOUR: Patient Distribution Introduction ... and treated in ED hallways, where they may remain for hours or days awaiting a hospital bed The 113 .9 million visits to EDs in the United States in 2003 represented a 26% increase from 1993 During ... Develop connected emergency plans Communicate during an MCE Be prepared for legal and ethical issues 11 Alter standards of care 12 Develop resilient medical surge Meta-leaders possess unique mindsets...
Ngày tải lên: 19/02/2014, 03:20
Upgrading IBM Systems Director Server on Windows and migrating to a Microsoft SQL Server or Microsoft SQL Server Express database Version 6 Release 3 pptx
... authentication If all of the previous statements are true, go to Step 11 If some or zero of the previous statements are true, go to Step 12 11 Update the IBM Systems Director Server service: a Click Start ... C:\Downloads\SQLJDBC\ extract\sqljdbc_4.0\enu Custom value: Examples: TCP/IP listener port ID for the database DbmsTcpIpListenerPort Default or custom value: Example: 1433 Whether IBM Systems Director ... actions and try again: v Check the tnsnames.ora file and the listener.ora file You might not have configured them correctly v Restart the listener service on your Oracle® Database Server Related...
Ngày tải lên: 31/03/2014, 16:20
Báo cáo y học: "Shared expression of phenotypic markers in systemic sclerosis indicates a convergence of pericytes and fibroblasts to a myofibroblast lineage in fibrosis" pdf
... Available online http://arthritis-research.com/content/7/5/R 1113 Figure No significant association was found between mean disease duration (p = 0 .11) and skin score (p = 0.97) and our immunohistochemical ... nuclear antigen (PCNA) (Abcam, UK) [34] Available online http://arthritis-research.com/content/7/5/R 1113 Table Clinical and serological characteristics of SSc patients Characteristics Fibrotic (n ... (39–72) 58 (37–69) Mean disease duration, months (range) 11 (4–18) 96 (36–168) Male/female 2/8 0/6 Mean skin score (range) 33 (19–41) 17 (11 24) Oesophageal 7/10 3/6 Other gastrointestinal 4/10...
Ngày tải lên: 09/08/2014, 07:20
Báo cáo y học: "Molecular model of the outward facing state of the human P-glycoprotein (ABCB1), and comparison to a model of the human MRP5 (ABCC5)" docx
... Genome Res 2001, 11( 7) :115 6 -116 6 Dassa E, Bouige P: The ABC of ABCS: a phylogenetic and functional classification of ABC systems in living organisms Res Microbiol 2001, 152(3-4): 211- 229 Walker JE, ... YAGCFRFGAYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMII~~~~~EKTPLIDSYSTEGLM 1027 111 0 ITTTGLMIVL~MHGQ~IPPAYAGLAISYAVQLTGLFQFTVRLASETEARFTSVERINHYIKTLSLEAP~~ARIKNK~APS 118 4 Sav1866 ABCB1 ABCC5 Walker A 910 PIEIKQGRIDIDHVSFQYNDN~EAPILKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNIKDFLT ... and that TMH2 and TMH11 are near each other [29] As shown in Figure 3A, the present ABCB1 model is consistent with these experimental data; TMH6/TMH12, TMH5/ TMH8 and TMH2/TMH11 are indeed adjacent...
Ngày tải lên: 13/08/2014, 16:21
a cross-cultural study on american-vietnamses verbal expressions in offering a gift and responding to a gift offer = nghiên cứu giao thoa văn hóa việt - mỹ về cách sử dụng ngôn từ để tặng quà và nhận quà
... getting cold in here” insinuating that it would be nice if the listener would get up and turn up the thermostat without directly asking the listener to so I.5 Offering as a speech act According to ... teacher opened the gift at once Vice versa, the teacher seemed to be impatient and embarrassed when listening to the monitor’s words “On the occasion of Vietnamese Teachers’ Day, we have a special ... information, etc between two or more persons The sender/speaker transmit message to the receiver/listener” However, communication is not merely an exchange of information An important function...
Ngày tải lên: 02/03/2015, 14:17
11 teaching and responding to writing
... When I listen to this story counted by my grandfather I began to tremble and I felt nervous for that I believed the goblin will appear in any moment and I felt a lot of fear but I like to listen ... about a concert/to persuade Audience: music fans Genre: poster Level: beginners/elementary Page 11 of 50 ICELT distance unit: teaching and responding to writing Writing activity B A friend is ... how about……? Or perhaps you'd…… Anyway, we can decide all this later I'll be at the airport at 11. 30 to meet you See you soon [Your name] Commentary Aim: to make some suggestions Audience: a...
Ngày tải lên: 27/07/2016, 15:49
Hear and listen to
... a) listens b) listens to c) hears Answers Did you hear the noise? I was listening to the news when they came I can’t hear you Can you talk a bit louder? Please listen to me Did ... several strange stories about him You never listen to me No one could hear what she said We heard the dogs barking outside 10 When he speaks, everybody listens Stay on top of your writing! Download...
Ngày tải lên: 29/08/2016, 20:38
Báo cáo hóa học: " Research Article Design and Implementation of a Lightweight Security Model to Prevent IEEE 802.11 Wireless DoS Attacks" pdf
... InterfaceTable tcp q: # udp q: # NetworkLayer 80 211 ACFNC NIC pingApp q: # Radio 80 211 ACFNC MAC 80 211 MgmtAP STSF Figure 5: Structure of the protected 80 211- ACFNC-NIC in the simulation environment ... Detection accuracy of the ACFNC model 0.045 0.04 0.035 0.03 0.025 0.02 0.15 0.01 0.005 0 0. 0116 0. 0114 0. 0112 0. 011 0.0108 0.0106 0.0104 0.0102 0.01 0.098 10 20 30 40 50 Time (s) TSF STSF (b) Figure ... we created a new management sublayer in the 80211ACFNC-NIC for the wireless stations and access point which are called 80211MgmtSTA-STSF and 80211MgmtAPSTSF, respectively The ACFNC source code...
Ngày tải lên: 21/06/2014, 05:20
Period 16 UNIT 3: A TRIP TO THE COUNTRYSIDE - Lesson 2: Speak and Listen doc
... the board Group A * Answers: Group B Have Ss work in groups -Listen to the 1-B 7-H -Get them to look at the map, tape and the 2-E 8-D listen to the trip to Ba's task Get ready 3-G 9-I village and ... +(picture) words -parking lot (n); bãi đỗ xe -high way No 1: đường QL +(picture) +the place to stop cars Listen and take -westward (adv): hướng tây +(translation) notes -opposite direction (n): theo hướng ... report before Yhere is a big river flowing correct answers class across the village group work Listening: *Have Ss work in pairs Get them to use the questions above and the survey *Task Have...
Ngày tải lên: 13/07/2014, 01:21
Báo cáo y học: "Differential expression, function and response to inflammatory stimuli of 11β-hydroxysteroid dehydrogenase type 1 in human fibroblasts: a mechanism for tissue-specific regulation of inflammation" pps
... is 20 µm A indicates co-expression of 11 -HSD1 and ASO2 (CD90) in fibroblasts; B highlights co-expression of 11 -HSD1 and vWF in endothelial cells 11 -HSD, 11 -hydroxysteroid dehydrogenase type ... threshold line; ELISA, enzyme-linked immunosorbent assay; 11 -HSD = 11 -hydroxysteroid dehydrogenase To investigate the significance of 11 -HSD1 expression in fibroblasts, further studies were ... Expression of 11 -HSD1 in synovial tissue Co-localization of 11 -HSD1 with markers of endothelial cells (vWF), fibroblasts (ASO2/CD90), T-cells tissue (CD3), dendritic cells (CD11c) and lining...
Ngày tải lên: 09/08/2014, 08:22
be to and have to + lexical verbs and their modal meanings from functional and cognitive perspectives (a case study based on lifelines textbooks used in hanoi pedagogical university no 2
... Types of modality in Halliday‟s view 1.2.2.4 A cognitive approach to modality 11 1.2.2.5 Summary 13 1.2.3 Concept of semi-modality 13 1.3 Modal and semi- ... in English and Vietnamese equivalents However, hers does not go further into meaning in context 11 Chau, NDN (1999) set for the discussion on pragmatic interpretation of obligation meanings expressed ... correctness of the information through the use of the modal must In the case of a question, the listener‟s opinion is involved, as well as the person obviously referred to by the sentence “What...
Ngày tải lên: 02/03/2015, 14:30
be to and have to + lexical verbs and their modal meanings from functional and cognitive perspectives (a case study based on lifelines textbooks used in hanoi pedagogical university no 2 tt
... Types of modality in Halliday‟s view 1.2.2.4 A cognitive approach to modality 11 1.2.2.5 Summary 13 1.2.3 Concept of semi-modality 13 1.3 Modal and semi-...
Ngày tải lên: 02/03/2015, 14:30
A computational study to investigate the effects of insulation and EGR in a diesel engine
... At Figures 11b, 11c, 11e, 11f the production of NOx and soot in the main and prechamber are discussed for three cases at both part and full loads operation It can be seen from Figure 11b that at ... low swirl ratio and the insufficient oxygen mass available It can be seen from Figures 11a, 11b, 11d and 11e that the NOx formation in the main chamber is intensified in areas with equivalence ... soot appears at almost the same time of the flame (at 380°ATDC of Conventional, in Figures 11a and 11c ) As the formation of the dense soot continues throughout the injection period due to the...
Ngày tải lên: 05/09/2013, 16:11
A STUDY ON UNREAL CONDITIONAL SENTENCES AND WAYS TO TRASLATE THEM INTO VIETNAMESE
... little more brains, I might take something of him [6:83] ( Giá thông minh chút, giúp cho đồ đấy.) [5 :111 ] If she got no money from her brother - in -law, she got what was as good as money -credit [6:103] ... literature writings Writings Non-personal correspondence Drama Propaganda Publicity 10 Public notices 11 Popular fiction In brief, semantic translation is used for expressive texts; communicative translation ... see that the subjunctive form of the verb “ở” (live) is identical with its infinitive form, so listeners cannot be sure whether the condition in the if-clause is negated or not Furthermore, the...
Ngày tải lên: 11/12/2013, 23:57
Tài liệu The Five Most Dangerous Issues Facing Sales Directors Today, and How to Guarantee a Permanent Improvement in Sales Results pdf
... and informal mentoring, sales coaching by managers, and/or classroom training, distance- or e-learning, and other kinds of training q MENTORING In mentoring, salespeople choose a mentor (a high-performer ... to teach it to others, mentoring programs offer organizations a win-win proposition: in addition to enhancing the skills and performance of the salespeople, they help mentors develop their sales ... existing salespeople Existing salespeople formed a core of mentors who would each shepherd a trainee through the 18-month learning process Mentors committed to spending at least 40% of their workweek...
Ngày tải lên: 20/12/2013, 19:15
Design, fabrication, and characterization of a solenoidsystem to generate magnetic field for an ECR proton source
... 80 mm φ150 8250 12950 Rectangular with cross-section mm × mm × hole diameter mm 144, 12, 12 110 , 10, 11 144, 12, 122 95 m 80 m 95 m 0·146 ohms 0–32 V, 100 A dc (Three) 0·127 ohms 0·156 ohms Fabrication ... layers (L) {i.e 144 turns (N)}, and the central solenoid coil had 10 turns/layer (N/L) and 11 layers (L) {i.e 110 turns (N)} The total length of the conductor used for the side solenoid coils and ... Acquisition and analysis of Langmuir probe characterization for ECR plasma Indian J Phys 80: 1 011 1015 Jain S K, Jain A, Hannurkar P R, Kotaiah S 2007 Characterization of plasma parameter, first...
Ngày tải lên: 22/12/2013, 08:58