... the sea This rough topographical feature makes the approaching typhoons to dissipate quickly but their intensities remain significant The coastline in this region is in the NorthwestSoutheast ... single wall (the brick wall with the thickness of 100 -110 mm) can also be used but strengthened with pillars at the distance of 2. 5m in order to increase the stability and stiffness of the single ... typhoons coming Before typhoon coming, people living in the cyclonic regions usually ask the authorities for the ways to strengthen their houses (existing) Therefore, the following are the solutions...
Ngày tải lên: 01/04/2013, 22:47
... Cities, said, "Therefore, in many New Towns finished years ago, such as Linh Dam, there is still a serious lack of kindergartens, schools, hospitals and markets" "We don’t have state schools at ... components: Bac Linh Dam (North of Linh Dam), Linh Dam peninsula in the middle and Linh Dam expansion (South of Linh Dam) The success of the project has set the stage for a series of New Towns that ... this New Town is for multistory apartments, the rest is for villas, street houses, public buildings, green areas and open spaces The realizations of selected case study show some basic spatial...
Ngày tải lên: 29/08/2013, 08:15
LINH DAM NEW TOWN - SOLUTION FOR THE HIGH-DENSITY DEVELOPMENT OF NEW SETTLEMENTS IN THE SOUTH-WEST OF HANOI
... thuê trọ theo ngày (đêm), lại thuê nhà theo tháng Có khoảng 22 ,86% nữ lao động tự phải s ng nơi có điều kiện sinh hoạt không đảm bảo, vệ sinh; 40,95% không s dụng nước có không ổn định; 11, 43% ... vật chất, tinh thần lao động nghèo nàn Họ thường tiêu tiết kiệm cho khoản chi phí sinh hoạt thiết yếu Có 22 ,86% nữ lao động tự phải s ng nơi có điều kiện sinh hoạt thiếu thốn, vệ sinh Họ thường ... hàng rong (n = 35) (n = 35) Giờ/ngày 12, 71 13,09 11, 99 Ngày/tháng Chỉ tiêu 28 ,43 22 ,9 20 ,04 Đơn vị tính S làm việc trung bình S ngày làm việc trung bình S tháng làm việc trung bình (n = 35)...
Ngày tải lên: 29/08/2013, 08:15
NEW FOODS IN THE SOUTHERN NEW WORLD
... Aztecs and the Incas as a hedge against years of poor harvests, correctly understanding that such storehouses, brimming with grains and dried meats, were sources of enormous power They were less ... of its domestication is by no means the only controversy this mysterious plant has sparked As we discuss in Chapter 13, sweet potatoes are also suspected of somehow finding their way to Australia, ... is home to several cucurbits, among them the crookneck and winter squash as well as achokcha (Cyclanthera pedata) – used in soups and stews Similarly, the pineapple is of South American origin...
Ngày tải lên: 01/11/2013, 11:20
Tài liệu NEW ADVANCES IN THE BASIC AND CLINICAL GASTROENTEROLOGY docx
... nutrients in the gut Another point of interest in this study is that despite large differences in dose, the two single strains did not have statistically different effects, suggesting strain-specificity ... Th2 cytokines in the neonatal period During the first year of life, an increase in Th2 responsiveness is seen in infants developing atopic disease, whereas a reverse development takes place in ... prevalent in the small intestine The intestinal immune system is referred as GALT (gut-associated-lymphoid tissue) It consists of Peyer s patches, which are units of lymphoid cells, single lymphocytes...
Ngày tải lên: 12/02/2014, 16:20
Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc
... proliferation Besides the functions of AP- 2s in physiological processes, they have also crucial roles in pathological processes such as tumorigenesis and genetic diseases [47] Most analyses of the regulation ... MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGPYSSAPPLSHT -MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHT -MLVHTYSAME -RPDGLG-AAAGGARLSSLPQAAYGPAPPLCHT -MSTTFPGLVHDAEIRHDGSNSYRLMQLGCLESVANSTVAYSSSSPLTYS ... limbs [17–19] Donner et al tried to link the expression of AP-2a in these tissues to upstream signaling pathways They assessed the organization of a cis-regulatory region within the fifth intron specific...
Ngày tải lên: 16/02/2014, 09:20
Tài liệu Báo cáo Y học: Soluble silk-like organic matrix in the nacreous layer of the bivalve Pinctada maxima A new insight in the biomineralization field pptx
... continuous smear after silver staining (Fig 4) No discrete individual bands were observed in the WSM sample However, the EDTA-SM revealed two distinct proteins around 14 and 20 kDa, still presenting ... sign of this dissimilarity For the FTIR spectra, the main differences were as follows: first, the presence of sulfate groups and several bands corresponding to polysaccharides in the EDTA-SM, which ... The electrophoretic pattern of WSM did not give significant information on its protein composition The continuous smear suggests the presence of GAGs or other sugars bound to the proteins, despite...
Ngày tải lên: 21/02/2014, 01:21
New Advances in the Basic and Clinical Gastroenterology Edited by Tomasz Brzozowski potx
... nutrients in the gut Another point of interest in this study is that despite large differences in dose, the two single strains did not have statistically different effects, suggesting strain-specificity ... Th2 cytokines in the neonatal period During the first year of life, an increase in Th2 responsiveness is seen in infants developing atopic disease, whereas a reverse development takes place in ... Biosciences, Oxford, UK) contains the stains, thiazole orange and propidium iodide (Doherty et al., 20 09) Cells stained using these kits can also be assessed using microscopes, which will also distinguish...
Ngày tải lên: 07/03/2014, 20:20
Báo cáo khoa học: Structural features in the C-terminal region of the Sinorhizobium meliloti RmInt1 group II intron-encoded protein contribute to its maturase and intron ppt
... reverse splicing of the intron RNA into the insertion site in the DNA are shown at the top Solid lines indicate DNA and dashed lines correspond to intron RNA the RmInt1 IEP domain X (positions 29 3–419) ... control in the assays Schematic diagrams of the mobility assays are shown at the top (not drawn to scale) The SalI restriction sites (S) in the plasmids as well as the orientation of the target ... support issues arising from supporting information (other than missing files) should be addressed to the authors FEBS Journal 27 7 (20 10) 24 4 25 4 ª 20 09 The Authors Journal compilation ª 20 09 FEBS ...
Ngày tải lên: 15/03/2014, 09:20
Báo cáo khóa học: Characterization of novel structural features in the lipopolysaccharide of nondisease associated nontypeable Haemophilus influenzae pptx
... d strains [7,8] Gene functions have been identified in those strains that are responsible for most of the steps in the biosynthesis of the oligosaccharide portions of the LPS molecules The inner ... 16-OS-1HF showed the same derivatives as observed for 11- OS-1HF Methylation analyses of the minor fractions 11- OS -2, 11- OS-3 and 16-OS -2 showed the same major sugar derivatives Sequence analyses ... response LPS-OH LPS-OH Methylated sugar Tgm (strain 11) (strain 16) 11- OS-1 11- OS-1HF 11- OS -2 11- OS-3 16-OS-1HF 16-OS -2 Linkage assignment 2, 3,4,6-Me4-Glc 2, 3,4,6-Me4-Gal 3,4,6-Me3-Glca 2, 3,6-Me3-Gala...
Ngày tải lên: 16/03/2014, 16:20
Báo cáo Y học: Elucidation of the role of fructose 2,6-bisphosphate in the regulation of glucose fluxes in mice usingin vivo 13 C NMR measurements of hepatic carbohydrate metabolism docx
... Together, these results demonstrate that increased Fru -2, 6-P2 has similar metabolic effects in the fed as well as in the fasted state During the NMR experiments, the infusion of [1-13C] glucose was sufficient ... containing the glycogen C2 through C5 resonances (Fig 2A), which is enlarged in Fig 2B The increase of these signals is consistent with the spectral 4 422 I.-Y Choi et al (Eur J Biochem 26 9) Ó FEBS ... 6-phosphofructo-1-kinase by this biofactor is more potent than its inhibition of fructose-1,6bisphosphatase This is a significant observation because it offers the first in vivo assessment of the...
Ngày tải lên: 17/03/2014, 17:20
New Directions in the History of Nursing pot
... Nursing Association She is now working as Associate Professor in Nursing Studies, Telemark University College, Norway Brigid Lusk is presently an associate professor in the School of Nursing ... focused on caring through the processes of ʻbeing-for -the- otherʼ is the focus of analysis in the following section NURSING KNOWLEDGE, SKILLS AND CARING Analysing the ethics of care in this context ... enmeshed in an account that juxtaposes traditional masculine values with a disturbing incursion of the feminine In Britain since the Crimean war and in the USA since the Civil War (also known as...
Ngày tải lên: 22/03/2014, 15:20
New Apples in the Garden pptx
... whose cause was nameless Suddenly, she did not want to ask any more questions The wind was rattling the windows 13 Loved this book ? Similar users also downloaded James Henry Schmitz Ham Sandwich ... beside her in the darkness "No," he said slowly, "I don't think so I don't think there'll be a Crash." In spite of the warmth of the room, she could not suppress an involuntary shudder whose ... finally he was warned that General Electronics was an example of the pitfalls involved in investing in the socalled High Growth stocks Eddie turned off the radio in the parking lot as the closing...
Ngày tải lên: 22/03/2014, 18:20
BENEATH THE SURFACE - NEW DISCOVERIES IN THE ALEUTIANS pptx
... diver in cold water to warm his hands The divers also found vents in the sandy areas of the seafloor 20 new species and counting Over the course of two summers and 440 dives, the scientists who surveyed ... from the dives are expected in 20 09 new walking or swimming anemone A few feet away the divers found the same creatures as in other areas — sea urchins, anemones, sponges and other organisms — seemingly ... this spring as the inaugural cohort in the campus’ licensed cosmetology pilot program The students spent the spring semester learning basic cosmetology theory and moved on to practical training...
Ngày tải lên: 29/03/2014, 03:21
new developments in the chemistry of war gasses 1950
... FLUOPHOSPHATES A INTRODUCTION This class comprises the diesters of fluophosphoric acid (I) ,the substituted diamidophosphoryl fluorides (11) , and other related subst,ances,such as the esters of alkylamido-substituted ... Because of this toxicity their use as water contaminants was considered during World War 11 Furthermore they are selective inhibitors of cholinesterase, but less potent in this respect than diisopropyl ... discovery of many interesting substances and to the development of several new methods of synthesis In addition, the results of the toxicological investigations shed new light on the relation between...
Ngày tải lên: 09/05/2014, 17:01
a new dataset in the making
... Figure 2b lists the agreements by continent, using the United Nations classification to assign countries to a continent. 12 We define agreements crossing regions as “cross-continent” Some of the ... profits from the host country to the home country Regarding the DSM, we assess the presence of a dispute settlement clause and also distinguish between an investor-state DSM and a state-state dispute ... Non-trade issues (“political” issues) The main objective in this design category is to list types of non-trade issues that are addressed in PTAs We focus on issues that are normally regulated in international...
Ngày tải lên: 02/06/2014, 09:22
coats & schauberger - nature as teacher - new principles in the working of nature (1998)
... colours The smallest wound festers and can only heal after the rotting season has passed The same applies to animals, since any wounds they suffer during this period are also incurable The young ... work (in its present sense) a sense of service will evolve for which humanity was destined since the beginning of time; service to Nature Such a service encompasses the organisation and dispensing ... a result of humanity 's misguided activity, the Earth is becoming increasingly unstable; an instability that is also reflected in the growing instability of human institutions These alarming events,...
Ngày tải lên: 04/06/2014, 12:23
analytic theology new essays in the philosophy of theology apr 2009
... Constantinopolitan Creed In this essay I shall not observe these distinctions since I am interested in the way theologians and churches formulate their discussion of Christian teaching, not the ... is right in thinking that Descartes was having a problem maintaining consistency in the premises of his natural theological arguments Suppose also that he is right in thinking that we have somehow ... addressing some of the concerns raised in earlier sections of this introduction In the next two essays, Thomas Crisp and Michael Sudduth, respectively, explore the ways in which sources other...
Ngày tải lên: 10/06/2014, 21:53