... electron density of the nucleus 1.2 Absorbance 0. 8 CD IBA 0. 6 IBA and CD CD derivative 0. 4 0. 2 0 200 400 600 800 100 0 1 200 Time Figure 3. 5: Change in absorbance (4 10 10 nm) for 15 hours 34 O Chapter ... Absorbance 0. 6 IBA 0. 5 IBA and CD 0. 4 CD derivative 0. 3 0. 2 0. 1 0 20 40 60 Time 80 100 1 20 Figure3.6: Change in the absorbance (at 4 10 10 nm) for the first 100 minutes The absorbance kinetics of paraoxon ... Properties of Nanofiber Membranes Type Membrane Thickness (μm) PVC 10 Mass per unit Area (mg/cm2) 0. 23 Apparent density (g/cm3) Porosity (%) 0. 23 83. 4 PVC + β-CD 14 0. 38 0. 27 80. 5 PVC + IBA 16 0. 30 0.19...
Ngày tải lên: 10/09/2015, 15:48
... PANSS 22 26 23 27 24 28 10 25 29 10 12 26 30 11 13 27 32 12 14 28 33 13 15 29 34 14 16 30 35 15 18 31 36 16 19 32 37 17 20 33 38 18 21 34 39 19 22 35 40 20 24 36 42 21 25 37 43 Note The 30 - Item Negative ... Validation 35 93 3594 Mean (sd) Mean (sd) t (7185) p 39 .49 (12.21) 39 . 43 (12.27) 0. 048 0. 962 0. 005 Positive 19. 43 (6. 60) 19.57 (6. 80) - 0. 961 0. 37 3 - 0. 021 Negative 22. 70 (6.92) 22.71 (6. 93) - 0. 049 0. 961 ... G8.Uncooperative 0. 431 0. 617 G 13. Disturbance of Volition 0. 426 0. 601 G1.Somatic Concern 0. 39 5 0. 541 G7.Motor Retardation 0. 38 2 0. 606 G 10. Disorientation 0. 38 2 10 0.441 G3.Guilt Feelings 0. 37 7 11 0. 431 G11.Poor...
Ngày tải lên: 11/08/2014, 16:20
Tài liệu USE OF INTERPRETERS FOR NON-ENGLISH SPEAKING PERSONS pdf
... effective November 5, 200 8, as follows: USE OF INTERPRETERS FOR NON-ENGLISH SPEAKING PERSONS INTRODUCTION Pursuant to the inherent powers of the Court and the Georgia Constitution of 19 83, and in order ... Nonpayment of any required renewal fees; or Violation of the Code of Professional Responsibility for Court Interpreters Commentary: The appropriateness of disciplinary action and the degree of discipline ... nature of the charge or the type of case before the court, the purpose of the proceedings and function of the court, the rights of a party or criminal defendant, and the responsibilities of a witness)...
Ngày tải lên: 10/12/2013, 05:15
Use of an extension of the park's transformation to determine control laws applied to a non sinusoidal permanent magnet synchronous motor
... : 1 ~ 100 2 10 2 40 t ora Figure 3: @ I m , @Irp , p and @Irq the position of the rotor versus Several control laws have been simulated with this motor and their performance compared 1 200 Voltage ... pC "0) which defmes "pseudo d q " axes, so that @Ird = 0. As io = , the expression of the torque of the motor will be nearly the same as the expression for a sinusoidal drive: T, = p.@', (0) i, ( 10) ... during the 1 20" inkrval of electrical angle where Wra is near of its maximal value @', supplied with a negative voltage -E during the 1 20" interval of eltvtrical angle where @Im is near of its minimal...
Ngày tải lên: 03/01/2014, 19:50
Báo cáo khoa học: "Unsupervised Recognition of Literal and Non-Literal Use of Idiomatic Expressions" potx
... “literal” (5 30 items, 472 of which are correct) than as “nonliteral” (37 3 items, 157 correct) Accuracy 68 .00 79.17 37 .35 11.11 47.82 85 . 03 69.66 64 .33 82.44 82 .33 60. 00 98.95 85.41 83. 43 88.89 93. 65 ... Rl Fl CForm 78.25 - Rep 79 .06 70. 00 5.96 10. 98 Graph 79.61 52.21 67.87 59 .02 LC 80. 50 62.26 26.21 36 . 90 LC-O 80. 42 53. 89 69 . 03 60. 53 Super 95.69 84.62 96.45 90. 15 Table 2: Accuracy, literal precision ... out all literal 16 39 20 688 17 34 11 862 non-literal 25 142 1 50 521 215 1 40 255 532 4 70 272 172 125 54 3 102 all 25 144 166 46 541 9 03 157 262 566 15 478 281 175 126 61 39 64 Table 1: Idiom statistics...
Ngày tải lên: 17/03/2014, 22:20
Báo cáo khoa học: "Use of soft X-radiography for early non-destructive detection of floral differentiation in Douglas fir buds" pptx
... chromosomic damage appeared, because of the small doses of radiation accumulated (25 rads for seems h of exposure which represents about 12 to the LD about , 50 20 000 rads for seeds, or to the doses ... apple or pear buds (2 00 0 to 00 0 rads) Improvements in the definition of radiographs can be expected and we are confident that there will be greater future developments of this technique in biology ... number of buds on September (table II) The date of floral transformation of some of the buds in these radiographs was estimated as being the same as on the excised shoots For the population of buds...
Ngày tải lên: 08/08/2014, 19:21
Báo cáo y học: " Gender-specific profiles of tobacco use among non-institutionalized people with serious mental illness" ppsx
... Index) < 63 (referent) 1 .0 – 1 .0 – 1 .0 – ≥ 63 1 .3 0. 8-2 .0 1 .0 0.5 - 2 .0 1.6 0. 8 - 3 .0 76 (38 .0% ) of the 200 women with schizophrenia spectrum disorders were current smokers 55 (32 .7%) of the 168 ... 1 .0 (719), p = 33 6 Somatic symptoms Depression 10. 8 12 .0 4 .3 5.4 10. 6 11.5 4.1 4.9 11.1 12.8 4.6 -1.6 (566.1), p = 100 3 6 .0 -3. 1 (522.4), p = 00 23 Anxiety 11.8 5 .3 11 .3 4.9 12.6 5.8 -3. 2 ( 533 .1), ... p = 1 50 13. 1 (2), p = 00 1 Current Former 34 1 46.8 156 21.4 226 91 51.8 20. 9 115 65 39 .2 22.2 Never 232 31 .8 119 27 .3 1 13 38.6 8.8 31 7.2 32 11.2 6 53 91.2 39 9 92.8 254 88.8 3. 9 17 4 .0 11 3. 8 688...
Ngày tải lên: 11/08/2014, 16:22
báo cáo khoa học: " Non-medical use of opioids among HIV-infected opioid dependent individuals on opioid maintenance treatment: the need for a more comprehensive approach" docx
... (-1 .35 ; -0. 76) 0. 06 0. 0 03 -3 < 10 -3 < 10 -3 < 10 -3 < 10 < 10 0 . 03 0. 20 -3 < 10 0 .01 0. 06 16 [7- 30 ] 36 6 (34 .9) 57 (5.5) 39 5 (37 .4) 824 (78.4) 124 32 119 196 -0. 29 ( -0. 39 ; -0. 22) -0. 25 ( -0. 46; -0. 03) -0. 26 ... (0. 29; 0. 62) 0. 62 (0. 44; 0. 81) 0. 98 0. 20 -3 < 10 0 . 03 0. 22 0. 20 -3 < 10 -3 < 10 -3 < 10 -0. 24 ( -0. 49; -0. 01) -0. 68 (-1.17; -0. 28) 0. 34 (0. 18; 0. 52) 0. 81 (0. 56; 1 .07 ) -0. 56 ( -0. 86; -0. 32 ) -1 .00 (-1 .35 ; ... 2 10 95 115 156 1 50 Coefficient (95 % CI) p-value 0. 00 ( -0. 41; 0. 37 ) 0. 16 ( -0. 09; 0. 39 ) -0. 69 ( -0. 96 ; -0. 43) -0. 24 ( -0. 45; 0. 00) -0. 13 ( -0. 39 ; 0. 08) 0. 15 ( -0. 07; 0. 40) 0. 91 (0. 67; 1. 20) 0. 45 (0. 29;...
Ngày tải lên: 11/08/2014, 18:20
Báo cáo y học: " Use of different but overlapping determinants in a retrovirus receptor accounts for non-reciprocal interference between xenotropic and polytropic murine leukemia viruses" ppt
... NPVITGQLPPSRPVQIRLPRPPQPPPTGAASMVPGTAPPSQQPGTGDRLLNLVDRAYQALNLTSPDKTQECWLCLVSGPP 31 9 3 20 31 6 31 6 NZB AKR6 1E FrMCF 3 30 3 40 3 50 3 60 3 70 3 80 3 90 400 YYEGVAVLGTYSNHTSAPANCSVASQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLAAPAGTIWACNTGLT ... UUUU x 106 x 104 AAAA < 10 20 UUAA < 10 80 AAUU x 105 x 104 UAAU x 104 x 1 03 AUUA x 106 10 UUUA x 105 < 10 AAAU AAUA No added receptor x 105 x 104 x 106 30 < 10 20 Figure of Analysis human/hamster ... 60 30 1 50 CHO/AAUA cells 1 20 AKR6 + 83A25 + secondary antibody 83A25 + secondary antibody 90 60 30 1 50 CHO/AAAU cells 1 20 90 AKR6 + 83A25 + secondary antibody 83A25 + secondary antibody 60 30 ...
Ngày tải lên: 13/08/2014, 09:21
common errors in the use of the english passive made by the grade 10 non-english majors at tran phu specialised high school, hai phong = những lỗi thường gặp ở thể bị động của học sinh không chuyên khối 10
... results Number of students: 70 Options A Questions 10 B c d e 10% 45% 85% 50% 20% 15% 55% 80% 40% 30 % 25% 50% 10% 6% 80% 25% 17% 85% 60% 70% 60% 5% 5% 60% 60% 28% - 5% 0% 24% 0% - - Table 10: Survey ... 90% 30 % 100 % 20% 95% 40% 100 % 97% - 58% 77% 70% 97% 74% 67% 37 % 11% 72% 56% 60% 65% 51% 12% 87% 40% 60% 45% 34 % 56% 70% - 40% 67% 48% 34 % 37 % 39 % 41% - Table 2: The statistic of correct answers ... 2.1 Definition of error 28 2.2 Error analysis 29 2 .3 Causes of errors 30 CHAPTER II – METHODOLOGY 33 Subject of the study 33 Setting 33 Research tools 34 Data collection procedures 36 i CHAPTER...
Ngày tải lên: 02/03/2015, 14:30
AN INVESTIGATION INTO THE USE OF ROLE PLAY FOR ENHANCING THE SECOND YEAR NON- ENGLISH MAJOR STUDENTS’ SPEAKING PERFORMANCE AT HANOI UNIVERSITYOF BUSINESS AND TECHNOLOGY Nghiên cứu về việc sử dụng đóng vai tình huống để nâng cao khả năng nói tiếng Anh của
... idea Sometimes 10 Never 3. 3 Always 34 56.7 Often 18 30 Sometimes 8 .3 Never Always 6.7 Often 11.6 Sometimes 12 20 Never 37 61.7 and take notes their ideas b I spend some time thinking of the c I am ... Of the same ability 50 83. 3 1.7 Of mixed ability Others 0 At random 10 Table 5: Students’ preference for choosing pairs or groups From the above table, a large number of the respondents ( 83. 3%) ... Percent of 27 Frequency (%) students a I only listen to my teacher and friends, Always 36 60 Often 15 25 Sometimes 11.7 Never 3. 3 Always 38 63. 4 question and wait for whether the Often 14 23. 3 teacher...
Ngày tải lên: 30/03/2015, 14:01
The relationship between the use of vocabulary learning strategies and learner autonomy of the first year non-major English students at Thainguyen University of Technology
... English proficiency Asian EFL Journal, 24/1, 1- 20 Retrieved November 24, 200 8 from the World Wide Web: http://www.asian-efl-journal.com/pta_nov _07 _dd .pdf 13 Fan, Y M ( 200 3) Frequency of use, perceived ... The reading Matrix 3/ 3, 1 -33 Retrieved September 12, 200 8 from the World Wide Web: http:www.readingmatrix.com/articles/john_liontas/restropective .pdf Ágota S & Anita S ( 200 0) Learner autonomy ... Learning (pp 15- 30 ) Englewood Cliffs, NJ: Prentice Hall 31 Sert, N ( 200 6) EFL student teachers’ learning autonomy The Asian EFL Journal Quarterly, 8/2, 1 80- 201 Retrieved September 12, 200 8 from the...
Ngày tải lên: 04/08/2015, 09:41
The use of the Internet tool as an assistance for first-year non-major students at Namdinh University of Technology Education in basic English self-study
... Error 0. 51 439 7962 0. 494 708 846 Standard Deviation 2. 30 0 45762 2.212 405 217 Sample Variance 5.292 105 2 63 4.894 736 842 Range 8 Sum 2 23 2 90 Count 20 20 Confidence Level(95 .0% ) 1 .07 6647 30 5 1 . 03 5 437 512 Table ... 10. 75 Variance 5.292 105 2 63 4.7 236 84211 Observations 20 20 Pooled Variance 5 .00 7894 737 Hypothesized Mean Difference df 38 t Stat 0. 565 239 359 P(T
Ngày tải lên: 04/08/2015, 09:41
Common errors in the use of the English passive made by the grade 10 Non-English Majors at Tran Phu Specialised High School, Hai Phong
... Publishers Limited, 200 3 13 Micheal Swan Practical English Usage (Third Edition) Oxford University Press, 200 5 14 Quirk, R and S Greenbaum and G.Leech and J Svartrick A grammar of contemporary English ... English It helps teachers identify students’ strategies of language learning and their level of proficiency so that teachers can find out suitable ways to improve current situations These are the ... various and different in the way of making errors However, because of limited size, the study will concentrate on giving an analysis of errors made by only 70 students from two non-major classes...
Ngày tải lên: 10/08/2015, 19:51
Use of DDGS in Swine Diets
... digestible lysine (1 .35 and 1.15%) and methionine + cystine (0. 80 and 0. 65%), ME (33 40 and 33 90 kcal/kg), calcium (0. 95 and 0. 80% ) and total phosphorus (0. 80 and 0. 70% ) within Phases and 3, respectively ... Diets Table 3: Muscle Quality Characteristics from Grower-Finisher Pigs Fed Diets Containing 0, 10, 20, and 30 % DDGS 0% 10% 20% 30 % c 54 .3 55.1 55.8 55.5 L* 3. 2 3. 2 3. 1 3. 1 Color scored e 2.2 2 .0 ... Measure of tenderness c Table 4: Fat Quality Characteristics of Market Hogs Fed Corn-Soybean Meal Diets Containing 0, 10, 20 and 30 % DDGS 0% 10% 20% 30 % DDGS DDGS DDGS DDGS 3. 15a 3 .00 ab 2.84bc...
Ngày tải lên: 08/08/2012, 10:03
Báo cáo y học: "Use of chinese and western over-the-counter medications in Hong Kong"
... (0. 79, 1 .02 ) NS 60- 69 0. 93 (0. 73, 1.19) NS 0. 73 (0. 63, 0. 85) < 0. 001 0. 50 (0. 38 , 0. 67) < 0. 001 0. 49 (0. 42, 0. 57) < 0. 001 < 0. 001 Reference 1 . 03 (0. 96, 1. 10) NS Age 70 or above Education level ... valuesa < 0. 001 Gender Male Female 38 .2 39 .6 12.5 9.9 49 .3 50. 5 Age 15-29 36 .6 12 .0 51.4 30 - 39 34 .3 11.8 53. 9 40- 49 33 .8 13 .0 53. 2 50- 59 37 .5 12 .3 50. 2 60- 69 45.4 8.8 45.8 70+ 58.6 4.4 37 .0 Below ... 1 .31 (1.17, 1.46) 15-29 Reference 30 - 39 1.21 (1 .02 , 1.44) 0. 032 1 .09 (0. 98, 1.22) NS 40- 49 1.28 (1 .07 , 1. 53) 0. 007 1 .05 (0. 94, 1.18) NS 50- 59 1.14 (0. 93, 1 .39 ) NS 0. 90 (0. 79, 1 .02 ) NS 60- 69 0. 93...
Ngày tải lên: 25/10/2012, 10:06
Báo cáo y học: "Use of the measure your medical outcome profile (MYMOP2) and W-BQ12 (Well-Being) outcomes measures to evaluate chiropractic treatment: an observational study"
... (2-tailed) - 3 30 015 -.221* 107 3 20 018 05 8* 675 Activity (A) rs p (2-tailed) -.229* 1 03 - . 03 7* 792 -.268* 05 8 05 8* 682 Wellbeing (WB) rs p (2-tailed) - 512 < 00 1 - .31 1 02 2 -.445 00 1 35 8 00 8 Profile ... (48.5% 17 (51.5%) 39 .4 (17 .3) 40. 9 (18.4) 18 - 82 18-82 < 20 (9.6%) (9.1%) 20- 39 24 (46.1%) 14 (42.4%) 40- 59 < 60 15 (28.8%) (15.4%) Tx group (n = 33 ) Post-Tx data 10 ( 30 . 3% ) (18.2%) Gender Male Female ... (SD) 3. 9 (1.1) 3. 9 (1.1) 1.5 (1.2) Symptom S2 (SD) 3. 6 (1.2) 3. 5 (1.2) 1.5 (1.1) Activity A (SD) 3. 9 (1.4) 3. 9 (1.5) 1.4 (1.1) Well-being W (SD) 2.5 (1 .3) 2.6 (1 .3) 1.6 (1 .3) Profile P (SD) 3. 4...
Ngày tải lên: 25/10/2012, 10:06