đáp án thuế 02 2013

... significant correlation between the amount of disorder and the number of annotated functions (r = -0 .02, P > 0.3) This stark difference suggests that disorder plays a highly functional role on the ... Disordered proteins (c) 0.18 p.4 0.16 Mean dN/dS 0.14 -3 p

Ngày tải lên: 09/08/2014, 22:23

... pp 397– 402, 2004 [9] P P´ rez, C Hue, J Vermaak, and M Gangnet, “Color-based e probabilistic tracking,” in Proceedings of the 7th European Conference on Computer Vision-Part I (ECCV 02) , pp ... the 7th European Conference on Computer Vision-Part I (ECCV 02) , pp 661–675, London, UK, May 2 002 [10] D Xu, Y Wang, and J An, “Applying a new spatial color histogram in mean-shift based tracking ... analysis,” IEEE Transactions on Pattern Analysis and Machine Intelligence, vol 24, no 5, pp 603–619, 2 002 [14] Z Zivkovic and B Krose, “An EM-like algorithm for colorhistogram-based object tracking,”...

Ngày tải lên: 22/06/2014, 19:20

... HO 7028 74 POPTR_0010s11840 E-66 *DUF26 2.600 -0.240 N/A HO 7028 85 POPTR_0002s 2026 0 E-61 **Ethylene receptor (ETR1) 3.651 -0.280 N/A HO 7028 95 scaffold_20:856315 856454 E-45 *Unknown function HO703041 ... -1.034 0.860 HO 7028 30 POPTR_0010s01590 E-160 *Late embryogenesis abundant protein 3.065 -0.868 -0.983 * 0.561 HO 7028 37 POPTR_0015s06030 E-117 *Unknown fonction 3.065 -0.234 N/A HO 7028 74 POPTR_0010s11840 ... validations (Continued) HO 7027 41 POPTR_0007s12770 *Unknown function 0.000 -0.397 -0.679 * HO 7027 68 POPTR_0009s13750 E-28 **Farnesylated protein 2.145 -0.388 N/A HO 7028 22 POPTR_0010s00900 E-37...

Ngày tải lên: 11/08/2014, 11:21

... each company in each year according to Section Our time range from fiscal year 2 002 to 2007 and we mark year 2 002 as year And we get all the financial ratios and firm information from the Compustat ... 770 ROE 0.116*** (0.003) 0.001 (0.972) 0.058*** (0.000) 0.255*** (0.000) 770 DR -0.116*** (0. 002) -0. 002 (0.939) -0.058*** (0.000) 0.745*** (0.000) 770 p-values in parentheses: * p < 0.10, ** p ... constant 2 002 511210) (Bureau of dollars Labor Statistics 2009) 46 Capital Fix Asset (Total Asset (at) minus Total Current Asset (act) minus Intangible Asset (intan)), converted to constant 2 002 dollars...

Ngày tải lên: 06/10/2015, 20:57

... using a cosmid 101 and other high-capacity vectors enable genomic libraries to be constructed 102 Vectors for other bacteria 104 Cloning Vectors for Eukaryotes 7.1 7.2 7.3 105 Vectors for yeast ... Analysis of proteins by in vitro mutagenesis 200 Different types of in vitro mutagenesis techniques 202 Using an oligonucleotide to create a point mutation in a cloned gene 203 Other methods of creating...

Ngày tải lên: 06/03/2014, 22:20

... Robinson CV (2 002) A tandem mass spectrometer for improved transmission and analysis of large macromolecular assemblies Anal Chem 74, 1 402 1407 18 Wang WJ, Russo SJ, Mulugeta S & Beers MF (2 002) Biosynthesis ... Educacion y Ciencia (SAF2006-04434), Instituto de Salud Carlos III (Ciberes-CB06 ⁄ 06 ⁄ 0 002) and CAM (S-BIO -026 0-2006) to C Casals DSC References Makin OS, Sikorski P & Serpell LC (2006) Diffraction ... nonspecific interstitial pneumonitis in one kindred Am J Respir Crit Care Med 165, 1322–1328 Nogee LM (2 002) Abnormal expression of surfactant protein C and lung disease Am J Respir Cell Mol Biol 26, 641–644...

Ngày tải lên: 07/03/2014, 05:20

... program from the Ministry of Education and Grant NSC 92–2320-B- 0021 74 from the National Science Council, Taiwan (LPC) and VGH-93– 302 from the Taipei Veterans General Hospital, Taiwan (SNS) References ... Falquet L, Pagni M, Bucher P, Hulo N, Sigrist CJ, Hofmann K & Bairoch A (2 002) The PROSITE database, its status in 2 002 Nucleic Acids Res 30, 235–238 Foster JA & Gerton GL (1996) Autoantigen of ... MGFVLFSQLPSFLLVSTLL.FLVISHSCRAQNSQ Y.DA TA DVG.E DDQV 60 Cyn d 24 KFSQDYAESKLKKDCKMVHSDSPYGENLMFGSGAISWKTT VDTWSDEKKSYHYGSNTC 102 Hordeum A.A.N N-QRIN LQ GG IFW AGAD ASDA.NS.VS D.D 113 Triticum G.A.S N-QRIN LQ GG IFW AGAD AADA.NA.VG...

Ngày tải lên: 07/03/2014, 12:20

... salvage pathway Nat Chem Biol 3, 492–497 Rodionov DA, Vitreschak AG, Mironov AA & Gelfand MS (2 002) Comparative genomics of thiamin biosynthesis in procaryotes New genes and regulatory mechanisms...

Ngày tải lên: 16/03/2014, 00:20

... DW (2 002) Tunga penetrans: molecular identification of Wolbachia endobacteria and their recognition by antibodies against proteins of endobacteria from filarial parasites Exp Parasitol 102, 201–211 ... Retinoid-binding proteins: mediators of retinoid action Biochem J 348, 481–495 Zimmerman AW & Veerkamp JH (2 002) New insights into the structure and function of fatty acid-binding proteins Cell Mol Life Sci ... Exp Parasitol 76, 156–164 McDermott L, Kennedy MW, McManus DP, Bradley JE, Cooper A & Storch J (2 002) How helminth lipidbinding proteins offload their ligands to membranes: differential mechanisms...

Ngày tải lên: 16/03/2014, 18:20

... (NT _024 397) GLUT4 (NT_010823) Class II (human) GLUT5 (NT _028 054) Class III (human) GLUT10 (NT_011362) 10 11 12 86 141 102 161 241 163 188 105 102 57 201 1468 197 96 161 241 163 188 105 102 204 ... 45 93 263 125 116 163 188 105 102 2566 256 93 161 241 163 188 105 102 204 219 2615 233 117 173 125 116 163 188 105 102 204 657 207 99 161 125 153 126 188 111 102 76 128 845 253 1284 123 136 2590 ... databases include: common carp ccGLUT1 (AAF75683); rainbow trout rtGLUT1A (AAF75681); chicken GLUT1 (AAB02037); mouse GLUT1 (AAA37752); rat GLUT1 (P11167) rabbit GLUT1 (P13355); bovine GLUT1 (P27674);...

Ngày tải lên: 17/03/2014, 03:20

... NaCl/Cit (1 ´ NaCl/Cit, 15 mM sodium citrate pH 7.0 and 0.15 M NaCl), 0 .02% Ficoll 400, 0 .02% polyvinylpyrrolidone, 0 .02% BSA, 0.1% SDS, and 0.1 mgámL)1 salmon testis DNA Hybridization was carried ... N-terminal sequence of the puri®ed spermosin was determined using a protein sequencer model Ó FEBS 2 002 Procise 492 (Applied Biosystems) The solubilized vitelline coat component, which is able to bind ... centrifuged at 10 000 g for 30 to obtain the supernatant as the solubilized vitelline coat Ó FEBS 2 002 Cloning and characterization of ascidian spermosin (Eur J Biochem 269) 659 Almost all the protein...

Ngày tải lên: 17/03/2014, 11:20

... using a cosmid 101 and other high-capacity vectors enable genomic libraries to be constructed 102 Vectors for other bacteria 104 Cloning Vectors for Eukaryotes 7.1 7.2 7.3 105 Vectors for yeast ... Analysis of proteins by in vitro mutagenesis 200 Different types of in vitro mutagenesis techniques 202 Using an oligonucleotide to create a point mutation in a cloned gene 203 Other methods of creating...

Ngày tải lên: 19/03/2014, 09:20

... mid-logarithmic phase (D595  0.4) under shaking conditions The cultures were diluted to D595  0 .025 and dispensed in 200-lL aliquots per well in 96-well plates The plates were incubated for up ... of tuberculosis: global trends and interactions with the HIV epidemic Arch Intern Med 163, 1009– 1021 2138 Parrish NM, Dick JD & Bishai WR (1998) Mechanisms of latency in Mycobacterium tuberculosis ... The Authors Journal compilation ª 2011 FEBS R K Gupta et al 15 16 17 18 19 20 21 DevR-DevS ⁄ Rv 2027 c 2-component signal transduction pathway to screen for novel antitubercular compounds J Biomol...

Ngày tải lên: 22/03/2014, 16:20

... suggests that the cloned Cc RNase cDNA 02 corresponds to the longer Cc RNase transcript Additionally, the recombinant protein expressed in Escherichia coli by Cc RNase 02 ORF exhibits ribonucleolytic ... accession number AJ441124), cDNA 02 (middle line, accession number AJ874689) and amino acid sequences (bottom line) are numbered on the right Nucleotides of the cDNA 02 that are identical those of ... indicates that the derived mRNAs 01 and 02 cannot derive from a primary transcript by alternative splicing An extensive analysis of the Cc RNase cDNA 02 sequence revealed that two putative polyadenylation...

Ngày tải lên: 23/03/2014, 06:20

... reference Modifications with respect to BS1 are shown within black boxes FEBS Journal 272 (2005) 190– 202 ª 2004 FEBS B 191 KNOX homeodomain–DNA interactions bands of similar intensity were observed ... for binding This means that all nucleotides in the protected area FEBS Journal 272 (2005) 190– 202 ª 2004 FEBS M F Tioni et al A KNOX homeodomain–DNA interactions B Fig Hydroxyl radical footprinting ... mutations of these two nucleotides abolish binding of HAKN1 to DNA On FEBS Journal 272 (2005) 190– 202 ª 2004 FEBS the other hand, because nucleotides at outside positions can be mutated without significant...

Ngày tải lên: 23/03/2014, 13:20

... Ministerio de Cultura y Educacion en el marco del Programa ´ ´ de Modernizacion Tecnologica (BID 802/ 0C-AR), Consejo Nacional ´ de Investigaciones Cientı´ ficas y Tecnicas (CONICET), Secretarı´ a...

Ngày tải lên: 23/03/2014, 15:21

... human acetylcholinesterase gene J Biol Chem 270, 23511–23519 Xu Y, Porntadavity S & St Clair DK (2 002) Transcriptional regulation of the human manganese superoxide dismutase gene: the role of specificity ... (1999) Expression of MXI1, a Myc antagonist, is regulated by Sp1 and AP2 J Biol Chem 274, 28794–28 802 FEBS Journal 276 (2009) 1114–1124 ª 2009 Hunan Normal University Journal compilation ª 2009 FEBS...

Ngày tải lên: 30/03/2014, 02:20

... as means of gene therapy and study of gene expression in cardiovascular disease Circ Res 82, 1023 – 1028 Yamasaki K, Asai T, Shimizu M, Aoki M, Hashiya N, Sakonjo H, Makino H, Kaneda Y, Ogihara ... domain protein Nucleic Acids Res 27, 1251–1262 18 Pendergrast PS, Wang C, Hernandez N & Huang S (2 002) FBI-1 can stimulate HIV-1 Tat activity and is targeted to a novel subnuclear domain that includes ... ⁄ POZ domain protein FBI-1 J Biol Chem 278, 29327–29335 Lee DK, Suh D, Edenberg HJ & Hur MW (2 002) POZ domain transcription factor, FBI-1, represses transcription of ADH5 ⁄ FDH by interacting...

Ngày tải lên: 30/03/2014, 04:20

... X56136; cenprosin, Y09123; cyprosin A, X69193; cyprosin B, X81984; VuAP1, AF287258; DSA4, AF08 2029 ; SoyAP1, AB069959; and SoyAP2, AB070857 Cardosin amino acid sequences were deduced from the ... related genes by subtractive hybridisation Plant Mol Biol 33, 821–834 Chen X, Pfeil JE & Gal S (2 002) The three typical aspartic proteinase genes of Arabidopsis thaliana are differentially expressed ... expression in transgenic potato and tobacco Mol Gen Genet 257, 132–142 Sassa H, Ushijima K & Hirano H (2 002) A pistil-specific thaumatin ⁄ PR5-like protein gene of Japanese pear (Pyrus serotina): sequence...

Ngày tải lên: 30/03/2014, 09:20

... Time-of-flight mass spectrometry for the structural analysis of bIologica molecules Anal Chem 64, 1027 A-1039A 12 Vestal, M L., Juhasz, P., and Martin, S, A (1995) Delayed extraction matnxassisted ... are also strongly influenced by fragmentation of the modlfying moiety Zaia 34 A 257 900 CMfH- 3021 + I 100 200 300 400 500 600 700 800 900 1000 1100 1200 m/z 100 200 300 400 500 600 700 800 900...

Ngày tải lên: 11/04/2014, 10:11