A novel 1540 nm light emission from erbium doped hydroxyapatite

Báo cáo khoa học: A novel antifungal hevein-type peptide from Triticum kiharae seeds with a unique 10-cysteine motif doc

Báo cáo khoa học: A novel antifungal hevein-type peptide from Triticum kiharae seeds with a unique 10-cysteine motif doc

... CGCTGGTTCTTGCCAGTCTCAGTGCCGTGGTTGCTAGGGAT TTTAGCACCACGAGCCTGGTCACCGCAACGCTGAGC CGCAGAAGCCGTACTTACCACAGCACAGGCAGTTCG GACTGGCAAGAACCAGCGCCACAGTAAGCGTCACCA GCTAGGATCCCTAGCAACCACGGCAC Table Antifungal activity ... of peptides was assayed against several Gram-positive and Gram-negative bacteria using radial diffusion assay Petri dishes with Luria–Bertani agar were seeded with test bacteria T...

Ngày tải lên: 07/03/2014, 02:20

10 505 0
Báo cáo hóa học: " Thickness-dependent optimization of Er3+ light emission from silicon-rich silicon oxide thin films" pdf

Báo cáo hóa học: " Thickness-dependent optimization of Er3+ light emission from silicon-rich silicon oxide thin films" pdf

... Thickness-dependent optimization of Er3 + light emission from silicon- rich silicon oxide thin films Nanoscale Research Letters 2011 6:395 Submit your manuscript to a journal and benefit from: Convenient ... (2006) P Horak, WH Loh, AJ Kenyon, Modification of the Er3+ radiative lifetime from proximity to silicon nanoclusters in silicon- rich silicon oxide Op...

Ngày tải lên: 21/06/2014, 03:20

6 301 0
Báo cáo hóa học: "Localized-Surface-Plasmon Enhanced the 357 nm Forward Emission from ZnMgO Films Capped by Pt Nanoparticles" ppt

Báo cáo hóa học: "Localized-Surface-Plasmon Enhanced the 357 nm Forward Emission from ZnMgO Films Capped by Pt Nanoparticles" ppt

... ZnMgO film capped with the Pt NPs is enhanced by sixfold via the coupling between the Pt LSP and the band-gap emission of ZnMgO Though the enhancement ratio is far away from the theoretical value, ... consistent with the band-gap of the ZnMgO film obtained from Fig 2, inferring the band-gap emission from ZnMgO The PL peak intensity of the refere...

Ngày tải lên: 21/06/2014, 20:20

5 187 0
Báo cáo hóa học: " Visible emission from Ce-doped ZnO nanorods grown by hydrothermal method without post thermal annealing process" ppt

Báo cáo hóa học: " Visible emission from Ce-doped ZnO nanorods grown by hydrothermal method without post thermal annealing process" ppt

... Visible emission from Ce-doped ZnO nanorods grown by hydrothermal method without a post thermal annealing process Yong-Il Jung1,2, Bum-Young Noh1,2, ... light-emitting Ce-doped ZnO NRs by hydrothermal method without a post thermal annealing process Experimental details Growth of undoped and Ce-doped ZnO NRs on Si (100) substrate The Ce-doped...

Ngày tải lên: 20/06/2014, 23:20

14 295 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... T thermophilus E coli A pernix 277 277 283 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... (Osaka, Japan) Emulgen 911 was a gift from Kao Chemical (Tokyo, Japan) NADPH, NADH and NADP+ were purchased from Oriental Yeast (Tokyo, Japan) a- Cyano-4-hydroxycinnamic ac...

Ngày tải lên: 18/02/2014, 08:20

14 617 0
Tài liệu Báo cáo khoa học: Isolation and molecular characterization of a novel D-hydantoinase from Jannaschia sp. CCS1 docx

Tài liệu Báo cáo khoa học: Isolation and molecular characterization of a novel D-hydantoinase from Jannaschia sp. CCS1 docx

... A novel high-activity D-hydantoinase from Jannaschia sp CCS1 obtain optically pure amino acids, namely chemical and enzymatic syntheses Chemical synthesis gives racemic mixtures of amino acids ... precipitate fraction; sup, supernatant fraction The molecular weight standard (lane M) is indicated on the right A novel high-activity D-hydantoinase from Jannaschia sp...

Ngày tải lên: 18/02/2014, 08:20

14 621 0
Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

... Several core oligosaccharides from Pseudomonas strains have already been isolated and characterized [12,13], mainly from Pseudomonas aeruginosa strains [21,37–43] The carbohydrate backbone of the ... Elucidation of the structure of the ¨ lipopolysaccharide core and the linkage between the core and the O-antigen in Pseudomonas aeruginosa immunotype using s...

Ngày tải lên: 19/02/2014, 13:20

14 716 0
Tài liệu Báo cáo khoa học: N-Methyl-L-amino acid dehydrogenase from Pseudomonas putida A novel member of an unusual NAD(P)-dependent oxidoreductase superfamily ppt

Tài liệu Báo cáo khoa học: N-Methyl-L-amino acid dehydrogenase from Pseudomonas putida A novel member of an unusual NAD(P)-dependent oxidoreductase superfamily ppt

... N-Methyl-L-amino acid dehydrogenase from P putida H Mihara et al ammonia are formed from methylamine and glutamate by N-methylglutamate synthase (EC 2.1.1.21) [16] Another A aminovorans strain, ... were of analytical grade from Nacalai Tesque (Kyoto, Japan) and Wako Pure Chemical Industries (Osaka, Japan) Culture and screening of bacteria Bacterial strains were cultivated...

Ngày tải lên: 19/02/2014, 16:20

7 518 0
Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high specific activity from Pisum sativum catalytically translocates in the 3¢fi5¢ direction docx

Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high specific activity from Pisum sativum catalytically translocates in the 3¢fi5¢ direction docx

... cross-react with antibodies against plant helicases including PDH45 and PDH65 and also against human DNA helicases I, II, III and IV (data not shown) ssDNA-dependent ATPase activity was present at a ... helicase have been shown to play a role in DNA Ó FEBS 2003 A novel nuclear DNA helicase from Pisum sativum (Eur J Biochem 270) 1743 Fig Effect of DNA interacti...

Ngày tải lên: 20/02/2014, 11:20

11 574 0
Tài liệu Báo cáo Y học: A novel meta-cleavage dioxygenase that cleaves a carboxyl-groupsubstituted 2-aminophenol Purification and characterization of 4-amino-3-hydroxybenzoate 2,3-dioxygenase from Bordetella sp. strain 10d doc

Tài liệu Báo cáo Y học: A novel meta-cleavage dioxygenase that cleaves a carboxyl-groupsubstituted 2-aminophenol Purification and characterization of 4-amino-3-hydroxybenzoate 2,3-dioxygenase from Bordetella sp. strain 10d doc

... Morphological and phenotypic characterization Physiological and biochemical parameters, such as Gram reaction, flagella type, catalase activity, oxidase activity and OF test, were determined using classical ... molecular mass of 4-amino-3-hydroxybenzoate 2,3 -dioxygenase is smaller than that of well-known extradiol dioxygenases, such as catechol 2,3 -dioxygenase [2], protoc...

Ngày tải lên: 21/02/2014, 01:21

7 490 0
Tài liệu Báo cáo Y học: A novel, inducible, citral lyase purified from spores of Penicillium digitatum docx

Tài liệu Báo cáo Y học: A novel, inducible, citral lyase purified from spores of Penicillium digitatum docx

... and average spore size did not change during induction Stability of citral lyase activity The activity and stability of citral lyase was dramatically affected by the addition of 20% (v/v) glycerol ... conversion of citral at high pH [18] For the enzymatic equivalent of this reaction the actions of a hydratase and an aldolase are needed Citral lyase of P digitatu...

Ngày tải lên: 21/02/2014, 01:21

8 577 0
Tài liệu Báo cáo khoa học: Characterization and functional expression of cDNAs encoding thyrotropin-releasing hormone receptor from Xenopus laevis Identification of a novel subtype of thyrotropin-releasing hormone receptor ppt

Tài liệu Báo cáo khoa học: Characterization and functional expression of cDNAs encoding thyrotropin-releasing hormone receptor from Xenopus laevis Identification of a novel subtype of thyrotropin-releasing hormone receptor ppt

... second set, A5 2 (5¢AGAGTGAGCAGGTAGCGAGAGGAG-3¢)/TRHR-8 (5¢-GGGGGTGTAGAGGTTTCTGGAGAC-3¢); third set, A5 3 (5¢-CGAGAGGAGCATTAGA-TAGATG Ó FEBS 2002 CAG-3¢)/TRHR-9 (5¢-GCCGAAATGTTGATGCCCA GATAC-3¢) (Fig ... CGTAACTTTTGCTG-3¢)/TRHR1-4 antisense (5¢-TC TGTTAAATGTACCTAAGTAGGCA-3¢) and TRHR2-2 sense (5¢-CAGCAAAATGGAAAATAGTAGC-3¢)/ TRHR2-4 antisense (5¢-CGACACTGTAGTAG-AGAT CACC-3¢), respectively...

Ngày tải lên: 21/02/2014, 03:20

11 507 0
Báo cáo khoa học: A novel mechanism of V-type zinc inhibition of glutamate dehydrogenase results from disruption of subunit interactions necessary for efficient catalysis doc

Báo cáo khoa học: A novel mechanism of V-type zinc inhibition of glutamate dehydrogenase results from disruption of subunit interactions necessary for efficient catalysis doc

... fragment relative quantitation was achieved using the ratio of the height of the emerging peak to that of the undigested GDH For MALDI-TOF calibration purposes, BSA was used as a standard and was diluted ... substrates (glutamate or norvaline) and zinc impact the overall stability and local flexibility of the enzyme As shown in Table 4, the addition of zinc to enzyme alone c...

Ngày tải lên: 05/03/2014, 23:20

12 544 0
Báo cáo khoa học: A novel metallocarboxypeptidase-like enzyme from the marine annelid Sabellastarte magnifica – a step into the invertebrate world of proteases pdf

Báo cáo khoa học: A novel metallocarboxypeptidase-like enzyme from the marine annelid Sabellastarte magnifica – a step into the invertebrate world of proteases pdf

... annulata, Budonosoma granulifera, Cassiopea xamachana, Condylactys gigantea, Gorgonia ventalina, Lebrunia danae, Palythoa caribaeorum, Physalia physalis, Plexaura homomalla, Stichodactyla helianthus ... Phyla Cnidaria, Annelida, Mollusca, Echinodermata, Arthropoda and Chordata, amongst others, collected on the coasts of Havana, Cuba The 4876 Fig S magnifica Phylum Annelida, Class Polyc...

Ngày tải lên: 07/03/2014, 02:20

16 628 0
Báo cáo khoa học: Purification and structural analysis of the novel glycoprotein allergen Cyn d 24, a pathogenesis-related protein PR-1, from Bermuda grass pollen pot

Báo cáo khoa học: Purification and structural analysis of the novel glycoprotein allergen Cyn d 24, a pathogenesis-related protein PR-1, from Bermuda grass pollen pot

... we have purified, cloned and characterized Cyn d 24 as a novel pathogenesis-related protein from BGP Additionally, the identification of Cyn d 24 has identified the involvement of a novel class of ... AGAD AADA.NA.VG D. D 113 Zea AYA.S A- QRQG LI GG FW AGAD.SASDA.GS.VS QY.DHDT.S 112 Nicotiana AYA.N S-Q.AA NL HGQ AE -GDFMTAAKA.EM.V QY.DHD 118 Cyn d 24 DQGKM...

Ngày tải lên: 07/03/2014, 12:20

10 665 0
w