Changes of nutrient component of different genotype pumpkin

báo cáo hóa học:" Outcome of Different Nevirapine Administration Strategies in Preventin g Mother-to-Child Transmission (PMTCT) Programs in Tanzania and Uganda" docx

... 67%, and rates of women and infants ingesting it varied between 15% and 40%.[12-17] In this study, we compared different NVP administration strategies in the GTZ-supported PMTCT programs in Tanzania ... retained significant influence in multivariate analysis (Table 2) The rates of women receiving NVP and the rates of women and infants ingesting the drug were...

Ngày tải lên : 20/06/2014, 08:20

8
335
0

Báo cáo khoa học: " Changes of gastrointestinal argyrophil endocrine cells in the osteoporotic SD rats induced by ovariectomy" ppt

... reflect the change in the capacity of producing these hormones [8] In the present study, the changes of the argyrophil endocrine cells in the GI tract of SD rat after ovariectomy were observed by ... Gastrointestinal argyrophil cells in ovariectomized osteoporotic rats 185 Fig Argyrophil endocrine cells in the GI tract of sham; Most...

Ngày tải lên : 07/08/2014, 17:23

6
490
0

Báo cáo khoa học: "Changes of gastrointestinal argyrophil endocrine cells in the COLO205 tumor-implanted Balb/c-nu/nu mice" pps

... etanobracylop rep detacolla erew slaminA syad rof noitazitamilcca retfa desu erew )napaJ ,reviR selrahC ;tpiecer nopu dlo kw-6( ecim elamef un/un-c/blaB FPS neT o slamina latnemirepxE sdohteM dna slairetaM ... nI stluseR 962 giF ecnereffid tnacifingis a deredisnoc saw 50.0 naht ssel fo eulav-p a dna )ASU ,SSPS ;3.1.6 esaeleR( swodniW rof SSPS htiw atad fo ecnacifingis eht ezylana ot desu saw...

Ngày tải lên : 07/08/2014, 18:21

5
244
0

Báo cáo y học: "Analysis of the 5''''UTR of HCV genotype 3 grown in vitro in human B cells, T cells, and macrophages" potx

... different strains or types of HCV We are reporting the isolation and replication of HCV from patients infected by type strains of HCV These new isolates can be cultured in both B and T cells By contrast ... complexity of genotype HCV samples (A) Shannon entropy comparisons of genotypes and HCV ...

Ngày tải lên : 12/08/2014, 04:20

11
276
0

Báo cáo y học: " Ultrastructural changes of the intracellular surfactant pool in a rat model of lung transplantation-related events" pdf

... surfactant preparations via the trachea has no impact on the amount of the intracellular surfactant pool [39], recent data suggest that alterations of the intracellular surfactant can occur already ... that the alterations of intracellular surfactant were significantly associated with early postoperative oxygenation and total intubation time [26] The intrace...

Ngày tải lên : 12/08/2014, 13:22

10
323
0

Báo cáo y học: " Use of different but overlapping determinants in a retrovirus receptor accounts for non-reciprocal interference between xenotropic and polytropic murine leukemia viruses" ppt

... saline Endogenous alkaline phosphatase was inactivated by incubating the cells at 68°C for h Cells were then stained for alkaline phosphatase activity by incubating the cells over night in AP ... YYEGVAVLGTYSNHTSAPANCSVASQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLAAPAGTIWACNTGLT YYEGVAVLGTYSNHTSAPANCSVTSQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLASPAGTIWACSTGLT YYEGVAVLGTYSNHTSAPANCSAASQHKLTL...

Ngày tải lên : 13/08/2014, 09:21

12
227
0

Báo cáo khoa học: "Comparison of different pain scoring systems in critically ill patients in a general ICU" pdf

... measure pain levels in the absence of painful stimuli measuring pain AB and DT participated in revising the manuscript critically PB and HD participated in revising the manuscript critically and in ... to a light glabellar tap [19] Standard pain medication in the intensive care unit All patients received pain medication according to the local standard protocol, con...

Ngày tải lên : 13/08/2014, 10:20

8
185
0

A study of semantic and syntactic features of idioms relating to fruits in english and vietnamese

... enable - Study semantic and syntactic features of proverbs relating to fruits in English and Vietnamese - Study pragmatic features of idioms relating to fruits in English and Vietnamese ... Summary CHAPTER FINDINGS AND DISCUSSIONS 4.1 OVERVIEW 4.2 SEMANTIC AND SYNTACTIC FEATURES OF IDIOMS RELATING TO FRUITS (IsRTFs) IN ENG...

Ngày tải lên : 26/11/2013, 13:21

13
1.3K
8

Cost-benefit Analysis of Natural Disaster Risk Management in Developing Countries pdf

... Overall, the aims of this manual are: presenting methods for CBA in the context of disaster risk management in developing countries, outlining the potential of integrating disaster risk into economic ... over elements of Cost-Benefit Analysis for disaster risk management The main application of CBA in the context of disaster risk discussed here is...

Ngày tải lên : 16/03/2014, 02:20

84
599
1

Economics of Air Pollution and Health in Developing Countries: A Brief Literature Survey docx

... on the results of a literature search of buildings-related, business and legal databases, and interviews with insurance and risk management representatives aimed at finding information on the direct ... 'Estimating the Health Damage Costs of Air Pollution' , in Holgate, S., Koren, H., Samet, J and Maynard, R (Eds), Air Pollution and Health, Academic Press, Lond...

Ngày tải lên : 23/03/2014, 04:20

11
474
1

The effect of climate fluctuation on output in developing countries

... of this paper is conducting the research on the impact of climate fluctuation on the aggregate output of the developing countries, then answering two questions: "Is the relationship between temperature ... certainly offensive in the condition of climate variables The cross-sectional data of 60 countries is used to examine the climate role in de...

Ngày tải lên : 04/04/2017, 21:35

52
328
0

Báo cáo khoa học: Correlation between functional and structural changes of reduced and oxidized trout hemoglobins I and IV at different pHs doc

... order: iron(II)HbIV > met-HbIV > met-HbI > iron(II)-HbI The larger peroxidative activity of iron(II)-HbIV with respect to metHbIV is in line with previous data obtained with human HbA derivatives [7] ... [6] Figure shows the peroxidase activity of iron(II)- and met-forms of HbI and HbIV It is evident that the enzymatic activity decreases according to the order iron(II)-HbIV > met-Hb...

Ngày tải lên : 23/03/2014, 12:20

9
368
0

The chart below shows the amount of leisure time enjoyed by men and women of different employment status

Ngày tải lên : 04/10/2012, 10:02

1
2.8K
10

Báo cáo y học: "Effects of p-Synephrine alone and in Combination with Selected Bioflavonoids on Resting Metabolism, Blood Pressure, Heart Rate and Self-Reported Mood Changes"

... particularly in caffeine-sensitive individuals [39] The absence of changes in blood pressure, resting heart- rate and self-ratings in the four treatment groups involving p-synephrine, naringin and hesperidin ... studies involving p-synephrine [17, 18] The increase in RMR between Group 4, the combination of p-synephrine with 600 mg naringin and 100 mg hesper...

Ngày tải lên : 25/10/2012, 11:04

7
641
0

Báo cáo y học: "Changes of uterine blood flow after vaginal radical trachelectomy (VRT) in patients with early-stage uterine invasive cervical cancer"

... Ascending branch of right uterine artery B: Ascending branch of left uterine artery C: Descending branch of right uterine artery D: Descending branch of left uterine artery Identification of each vessel ... early in the second trimester in spite of no signs of threatened abortion Daily vaginal disinfection with popidone iodine, bed rest, and administration of r...

Ngày tải lên : 25/10/2012, 11:48

7
425
0

Changes of nutrient component of different genotype pumpkin fruits in developing

báo cáo hóa học:" Outcome of Different Nevirapine Administration Strategies in Preventin g Mother-to-Child Transmission (PMTCT) Programs in Tanzania and Uganda" docx

Báo cáo khoa học: " Changes of gastrointestinal argyrophil endocrine cells in the osteoporotic SD rats induced by ovariectomy" ppt