... adopting the functional grammar approach It The cultural aspect of the thematic structure of English and Vietnamese lyrics Theme structure of English and Vietnamese sentences The study is mainly concentrate ... in the means we consider the clause as a message At clause rank, the major textual system is THEME It is a resource for organizi...
Ngày tải lên: 14/05/2016, 18:38
Báo cáo khoa học: Purification of a plant nucleotide pyrophosphatase as a protein that interferes with nitrate reductase and glutamine synthetase assays pdf
... Co -purification of glutamine synthetase and nitrate reductase inhibitor proteins (A) Activity of glutamine synthetase (h) and nitrate reductase (j) in the presence of fractions from the final Mono-S ... trichloroacetic acid The A5 04 was measured and the c-glutamyl hydroxamate produced was quantified using commercial c-glutamyl hydroxamate as standard Control as...
Ngày tải lên: 08/03/2014, 08:20
Báo cáo y học: "Report of three cases that received maintenance treatment with risperidone as a mood stabilizer" ppsx
... Until today, only olanzapine has received official approval as monotherapy for the maintenance phase of bipolar illness Our data suggest that further research is necessary to investigate the long ... for treatment of acute mania: a double-blind, placebo-controlled comparison of efficacy and safety American Journal of Psychiatry 2002, 159:1146-1154 Yatham LN: Mood stabili...
Ngày tải lên: 08/08/2014, 20:23
Báo cáo y học: " Rapidly progressing, fatal and acute promyelocytic leukaemia that initially manifested as a painful third molar: a case report" potx
... [2,3] Acute promyelocytic leukaemia (M3-APL) is a malignant subtype of acute myeloid leukaemia (AML), comprising approximately to 13% of reported cases of leukaemia Prevalence is especially high among ... Globulin 30 mg/L Albumin 27 g/L Aspartate aminotransferase 30 U/L Alanine aminotransferase 31 U/L Alkaline phosphatase 75 U/L Gamma-glutamyl transferase 82 U/L Lactate dehydrog...
Ngày tải lên: 11/08/2014, 17:21
Báo cáo y học: " Amino acid residues that are important for Hyal2 function as a receptor for jaagsiekte sheep retrovirus" potx
... LQTHFRCQCYLGWGGEQCQWDRRRAAGGASGAWAGSHLTGLLAVAVLAFTWTS LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGSHLTSLLALAALAFTWTL LQKHFRCQCYLGWGGEQCQRNYKGAAGNASRAWAGSHLTSLLGLVAVALTWTL LQMHFRCHCYLGWGGEQCQWNHKRAAGDASRAWAGAHLASLLGLVAMTLTWTL ... LWAESTALFPSVYLEETLASSTHGRNFVSFRVQEALRVADVHHANHALPVYVFTRPTYSR LWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVARTHHANHALPVYVFTRPTYSR LWAESTALFPSVYLDETLASSVHSRNFVSFRVREALRVAHTHHANHALPVYVF...
Ngày tải lên: 13/08/2014, 09:21
Báo cáo y học: "Donnan effect on chloride ion distribution as a determinant of body fluid composition that allows action potentials to spread via fast sodium channels" pot
... determinant of body fluid composition that allows action potentials to spread via fast sodium channels Theoretical Biology and Medical Modelling 2011 8:16 Submit your next manuscript to BioMed Central and ... protein content is similar to that of the plasma A possible speculation is that with no Donnan effect to alter the IF ion composition, and...
Ngày tải lên: 13/08/2014, 16:20
INHIBITION OF APE1’S DNA REPAIR ACTIVITY AS A TARGET IN CANCER: IDENTIFICATION OF NOVEL SMALL MOLECULES THAT HAVE TRANSLATIONAL POTENTIAL FOR MOLECULARLY TARGETED CANCER THERAPY
... IDENTIFICATION OF NOVEL SMALL MOLECULES THAT HAVE TRANSLATIONAL POTENTIAL FOR MOLECULARLY TARGETED CANCER THERAPY The DNA Base Excision Repair (BER) pathway repairs DNA damaged by endogenous and exogenous ... times and the long distances Thanks for always being there for me and for being my number #1 fan v ABSTRACT Aditi Ajit Bapat INHIBITION OF AP...
Ngày tải lên: 24/08/2014, 13:10
The introduction of a system that would improve a manager’s ability to successfully supervise their employees, operating companies has been identified as a solution
... application all business rules has been saved on the database and database with application saved on the server The applications for accessing the database on the server should be used the stored ... data from within the database A login system can also be created by using data in the database where the login details will be stored in the database and the system...
Ngày tải lên: 17/01/2016, 19:35
Chapter adjs that clause adjs to infinitives
... was _ that the whole class got good results in the exam The coach was very that the team would win Nhi is that her study is becoming worse Ngoc is that her grandma is coming to stay ... week Lam and Ling are _ that the final exam is due very soon We are that they refused our offer The singer was that the whole auditorium was completely quite Doctor Binh is the patient ... expe...
Ngày tải lên: 25/08/2016, 00:05
Lab Linux phan I, II Installing Linux as a Server
... packages có tên samba rpm –qa samba* => liệt kê packages có tên bắt đầu samba rpm –qa | grep samba => liệt kê packages có tên ch a samba rpm –qd samba => liệt kê files tài liệu liên quan đến samba ... a Cao, Q.1, TP.HCM Tel: (84-8) 38244041 – 0989012418 www.athena.edu.vn - Bạn liệt kê danh sách packages cài đặt (Installed packages) danh sách packages dùng cho bạn download (Available package...
Ngày tải lên: 13/09/2012, 10:21