Adapting plan based re optimization of multiway join queries for streaming data

... satisfied in data- stream environments 2.2 Optimization for Streaming Data In this section, we will review approaches that are especially put forward for streaming settings, where queries are submitted ... intermediate results, and hence, they are the most challenging to re- optimize In this thesis, we concentrate on adapting plan- based re- optimization of multiway...

Ngày tải lên: 26/09/2015, 10:59

... Mbit/s Figure 6: LP -OFDM performance with channel model CM1 CONCLUSION In this paper, we have proposed a linear precoded multicarrier waveform, called LP -OFDM, for high data rate UWB applications ... Furthermore, Theorem shows that the LP -OFDM noise margin can never be lower than the OFDM noise margin The LP -OFDM system range is therefore larger than the OFDM system range T...

Ngày tải lên: 22/06/2014, 06:20

... Mbit/s Figure 6: LP -OFDM performance with channel model CM1 CONCLUSION In this paper, we have proposed a linear precoded multicarrier waveform, called LP -OFDM, for high data rate UWB applications ... Furthermore, Theorem shows that the LP -OFDM noise margin can never be lower than the OFDM noise margin The LP -OFDM system range is therefore larger than the OFDM system range T...

Ngày tải lên: 22/06/2014, 19:20

... on one group of MT systems evaluate the translation qualities of new systems? In this paper, we argue for the viability of a regression-based framework for sentence-level MTevaluation Through ... and Chris Brockett 2001 A machine learning approach to the automatic evaluation of machine translation In Proceedings of the 39th Annual Meeting of the Association for Com...

Ngày tải lên: 08/03/2014, 02:21

... NSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAA SGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ SNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEK GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ ... CGGGATCCCGGTTTCTTCTGAGGCTTCTCG CGGGATCCGGTGGCGCAGGCGG 83RGD -(as) 83RGD - (a) CGGGATCCCAGGGGTTTGATCACCGGTTT CGGGATCCACCGAACAGGGCGGGG 3'HVR5-(as) 5'HVR2-(s) GGCATGTAA...

Ngày tải lên: 20/06/2014, 01:20

... proof for part a of Theorem 1.2 by showing the following lemma 8 Journal of Inequalities and Applications Lemma 1.3 For any integer n ≥ 1, and for all x1 , , xn with each xk ∈ a, b and all ... show that this is indeed true for all admissible q, t, and x1 For the case x1 a, ψ q 1/ 1−q ta Because ta ≤ b a, ψ q ≥ 1/ b a When a < x1 ≤ b, the value of ψ q approaches...

Ngày tải lên: 22/06/2014, 03:20

... formula For the second formula, we note that L = − K −1 , and a formula for the coefficients of K −1 follows from (8.4) and (5.10) Applying Lemma 2.5 to Theorem 8.3 gives hook length formulas for ... h(v) of a vertex v in a forest is the number of descendants of v (including v) We will consider various kinds of trees and forests in this paper, and for each of them we wi...

Ngày tải lên: 07/08/2014, 08:22

... Page 12 of 12 doi:10.1186/gb-2010-11-10-r99 Cite this article as: Homer and Nelson: Improved variant discovery through local re-alignment of short-read next-generation sequencing data using SRMA ... Local re-alignment of simulated data Local re-alignment of empirical data To assess the performance of local re-alignment on a dataset with a known di...

Ngày tải lên: 09/08/2014, 22:23

... ANALYSIS, DESIGN AND OPTIMIZATION OF ENERGY EFFICIENT PROTOCOLS FOR WIRELESS SENSOR NETWORKS HOANG DUC CHINH (B.Eng., Hanoi University of Technology, Vietnam) A THESIS SUBMITTED FOR THE ... 21 1.3.4 Energy Efficient Routing and Optimization Methods in Wireless Sensor Networks 24 2.1 Introduction 24 2.2 Routing Protocols for Wireless Sensor Netwo...

Ngày tải lên: 10/09/2015, 09:04

... Comminution of licorice roots for extraction 43 2.2 Soxhlet extraction 43 2.3 Coventional extraction by maceration 44 2.4 Horizontal screw continuous countercurrent extraction 45 iii TABLE OF CONTENTS ... characteristics of licorice roots comminuted by cut milling for extraction study 68 Table Results of Soxhlet extraction 73 Table 10 Results of the op...

Ngày tải lên: 03/10/2015, 20:58

... 36636, 37488, 38340 Effective Quality-of-Service Renegotiating Schemes for Streaming Video 287 Table 10: Performance comparison between the proposed algorithm and bandwidth renegotiating scheme (test ... Effective Quality-of-Service Renegotiating Schemes for Streaming Video [6] Z.-L Zhang, J Kurose, J D Salehi, and D Towsley, “Smoothing, statistical multiplexing, and call...

Ngày tải lên: 23/06/2014, 01:20

... and 43% by using powdered activated carbon augmented activated sludge in landfill leachate Halim et al [7] studied a comparison study of ammonia and COD adsorption on zeolite, activated carbon and ... removal of organic substances were achieved at the addition of 50.0 g L−1 of activated carbon; remove up to 86% of COD and 63% of NH4+-N Kurniawan and Lo [11] repo...

Ngày tải lên: 05/09/2013, 16:10

... protein to the enzyme catalysing the following reaction The last switch allocates a nite fraction of protein to all enzymes whereby the rst enzyme of the chain (which has already done most of its ễworkế ... accompanied by concerted changes in the mRNA levels for most enzymes of the central metabolism of yeast resulting in down-regulation of glycolysis and up-regulation of...

Ngày tải lên: 17/03/2014, 10:20

... constructed domain plan Our tripartite model offers several advantages Ramshaw's model assumes that the top-level domain plan is given at the outset of the dialogue and then his model expands that plan ... in a plan-based discourse model In Proceedings of the 29th Annual Meeting of the ACL, Berkeley, CA, June 1991 [MP90] Conclusions We have presented a tripartite model...

Ngày tải lên: 31/03/2014, 06:20

... animation and image-based rendering of models [5] Image-based facial animation can achieve more realistic animations, while 3Dbased approaches are more flexible to render the talking head in any view and ... drives the talking head The speech-driven talking head uses phoneme information from original sounds Text-driven talking head is flexible and can be used in many appli...

Ngày tải lên: 21/06/2014, 20:20